Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-HDAC6 Polyclonal Antibody – Cat# AAA198381 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-Hdac6 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Testis)

Histone Deacetylase 6 (HDAC6) Antibody – Rabbit Polyclonal

Hdac6 Antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
Hdac6; Hd6; Sfc6; Hdac5; mHDA2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Immunohistochemistry, Chromatin Immunoprecipitation, Immunoprecipitation
Purity
Affinity Purified
Synonyms
Hdac6, Antibody; Hdac6 Antibody - C-terminal region; anti-HDAC6 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VCHHEASEHPLVLSCVDLSTWCYVCQAYVHHEDLQDVKNAAHQNKFGEDM
Sequence Length
1149
Applicable Applications for anti-HDAC6 antibody
IHC (Immunohistochemistry), ChIP (Chromatin immunoprecipitation)
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 86%; Horse: 85%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 86%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Hdac6
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-Hdac6 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Testis)

Rabbit Anti-HDAC6 Polyclonal Antibody – Cat# AAA198381 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-Hdac6 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Testis)

WB (Western Blot)

(Host: MouseTarget Name: HDAC6Sample Tissue: Mouse SpleenAntibody Dilution: 1ug/ml)

Rabbit Anti-HDAC6 Polyclonal Antibody – Cat# AAA198381 – WB (Western Blot) WB (Western Blot) (Host: MouseTarget Name: HDAC6Sample Tissue: Mouse SpleenAntibody Dilution: 1ug/ml)

IHC (Immunohiostchemistry)

(Rabbit Anti-Hdac6 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult heartObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy2/3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)

Rabbit Anti-HDAC6 Polyclonal Antibody – Cat# AAA198381 – IHC (Immunohiostchemistry) IHC (Immunohiostchemistry) (Rabbit Anti-Hdac6 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult heartObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy2/3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)

ChIP (Chromatin Immunoprecipitation)

(Chromatin Immunoprecipitation (ChIP) Using Hdac6 Antibody - C-terminal region and HCT116 Cells)

Rabbit Anti-HDAC6 Polyclonal Antibody – Cat# AAA198381 – ChIP (Chromatin Immunoprecipitation) ChIP (Chromatin Immunoprecipitation) (Chromatin Immunoprecipitation (ChIP) Using Hdac6 Antibody - C-terminal region and HCT116 Cells)
Related Product Information for anti-HDAC6 antibody
This is a rabbit polyclonal antibody against Hdac6. It was validated on Western Blot

Target Description: Hdac6 is responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Hdac6 plays a central role in microtubule-dependent cell motility via deacetylation of tubulin.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
126kDa
NCBI Official Full Name
histone deacetylase 6
NCBI Official Synonym Full Names
histone deacetylase 6
NCBI Official Symbol
Hdac6
NCBI Official Synonym Symbols
Hd6; Sfc6; Hdac5; mHDA2
NCBI Protein Information
histone deacetylase 6
UniProt Protein Name
Histone deacetylase 6
UniProt Gene Name
Hdac6
UniProt Synonym Gene Names
HD6
UniProt Entry Name
HDAC6_MOUSE

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The HDAC6 hdac6 (Catalog #AAA198381) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Hdac6 Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Hdac6 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), ChIP (Chromatin immunoprecipitation). Researchers should empirically determine the suitability of the HDAC6 hdac6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VCHHEASEHP LVLSCVDLST WCYVCQAYVH HEDLQDVKNA AHQNKFGEDM. It is sometimes possible for the material contained within the vial of "Hdac6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.