Guanylin (GUCA2A) Antibody – Rabbit Polyclonal
GUCA2A antibody - middle region
Gene Names
GUCA2A; GUCA2; STARA; GCAP-I
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Yeast
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GUCA2A, Antibody; GUCA2A antibody - middle region; anti-GUCA2A antibody
Product Overview
Host
Rabbit
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FAPIPGEPVVPILCSNPNFPEELKPLCKEPNAQEILQRLEEIAEDPGTCE
Sequence Length
115
Applicable Applications for anti-GUCA2A antibody
WB (Western Blot)
Homology
Cow: 83%; Guinea Pig: 77%; Horse: 85%; Human: 100%; Mouse: 91%; Pig: 82%; Rabbit: 83%; Rat: 100%; Sheep: 92%; Yeast: 90%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-GUCA2A antibody
This is a rabbit polyclonal antibody against GUCA2A. It was validated on Western Blot
Target Description: GUCA2A is an endogenous activator of intestinal guanylate cyclase. It stimulates this enzyme through the same receptor binding region as the heat-stable enterotoxins.
Target Description: GUCA2A is an endogenous activator of intestinal guanylate cyclase. It stimulates this enzyme through the same receptor binding region as the heat-stable enterotoxins.
Product Categories/Family for anti-GUCA2A antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
12kDa
NCBI Official Full Name
guanylin
NCBI Official Synonym Full Names
guanylate cyclase activator 2A
NCBI Official Symbol
GUCA2A
NCBI Official Synonym Symbols
GUCA2; STARA; GCAP-I
NCBI Protein Information
guanylin
UniProt Protein Name
Guanylin
UniProt Gene Name
GUCA2A
UniProt Synonym Gene Names
GUCA2; GCAP-I
UniProt Entry Name
GUC2A_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Additional Details
Product Notes
The GUCA2A guca2a (Catalog #AAA200074) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GUCA2A antibody - middle region reacts with Cow, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's GUCA2A can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the GUCA2A guca2a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FAPIPGEPVV PILCSNPNFP EELKPLCKEP NAQEILQRLE EIAEDPGTCE. It is sometimes possible for the material contained within the vial of "GUCA2A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
