Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-GTF2I Polyclonal Antibody – Cat# AAA200765 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-GTF2I Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 293T cell lysateThere is BioGPS gene expression data showing that GTF2I is expressed in HEK293T)

General Transcription Factor II-I Isoform 1 (GTF2I) Antibody – Rabbit Polyclonal

GTF2I antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
GTF2I; WBS; DIWS; SPIN; IB291; BAP135; BTKAP1; TFII-I; WBSCR6; GTFII-I
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
GTF2I, Antibody; GTF2I antibody - middle region; anti-GTF2I antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: INNQLVDQSESEGPVIQESAEPSQLEVPATEEIKETDGSSQIKQEPDPTW
Sequence Length
998
Applicable Applications for anti-GTF2I antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 92%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human GTF2I
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-GTF2I Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 293T cell lysateThere is BioGPS gene expression data showing that GTF2I is expressed in HEK293T)

Rabbit Anti-GTF2I Polyclonal Antibody – Cat# AAA200765 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-GTF2I Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 293T cell lysateThere is BioGPS gene expression data showing that GTF2I is expressed in HEK293T)

WB (Western Blot)

(Host: MouseTarget Name: GTF2ISample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)

Rabbit Anti-GTF2I Polyclonal Antibody – Cat# AAA200765 – WB (Western Blot) WB (Western Blot) (Host: MouseTarget Name: GTF2ISample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)

IHC (Immunohistochemistry)

(Rabbit Anti-GTF2I AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:100Other Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Rabbit Anti-GTF2I Polyclonal Antibody – Cat# AAA200765 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Rabbit Anti-GTF2I AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:100Other Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-GTF2I antibody
This is a rabbit polyclonal antibody against GTF2I. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: GTF2I is a multifunctional phosphoprotein with roles in transcription and signal transduction. It is deleted in Williams-Beuren syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at chromosome 7q11.23.This gene encodes a multifunctional phosphoprotein with roles in transcription and signal transduction. It is deleted in Williams-Beuren syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at chromosome 7q11.23. The exon(s) encoding 5' UTR has not been fully defined, but this gene is known to contain at least 34 exons, and its alternative splicing generates 4 transcript variants. This gene encodes a multifunctional phosphoprotein with roles in transcription and signal transduction. It is deleted in Williams-Beuren syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at chromosome 7q11.23. Four transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
112kDa
NCBI Official Full Name
general transcription factor II-I isoform 1
NCBI Official Synonym Full Names
general transcription factor IIi
NCBI Official Symbol
GTF2I
NCBI Official Synonym Symbols
WBS; DIWS; SPIN; IB291; BAP135; BTKAP1; TFII-I; WBSCR6; GTFII-I
NCBI Protein Information
general transcription factor II-I
UniProt Protein Name
General transcription factor II-I
UniProt Gene Name
GTF2I
UniProt Synonym Gene Names
BAP135; WBSCR6; GTFII-I; TFII-I; BAP-135; BTK-associated protein 135; SPIN
UniProt Entry Name
GTF2I_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The GTF2I gtf2i (Catalog #AAA200765) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GTF2I antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GTF2I can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the GTF2I gtf2i for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: INNQLVDQSE SEGPVIQESA EPSQLEVPAT EEIKETDGSS QIKQEPDPTW. It is sometimes possible for the material contained within the vial of "GTF2I, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.