Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-GTF2H3 Polyclonal Antibody – Cat# AAA197170 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-GTF2H3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:2500Positive Control: Jurkat cell lysateGTF2H3 is supported by BioGPS gene expression data to be expressed in Jurkat)

General Transcription Factor IIH Subunit 3 Isoform A (GTF2H3) Antibody – Rabbit Polyclonal

GTF2H3 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
GTF2H3; P34; BTF2; TFB4; TFIIH
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
GTF2H3, Antibody; GTF2H3 antibody - N-terminal region; anti-GTF2H3 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VIASHIQESRFLYPGKNGRLGDFFGDPGNPPEFNPSGSKDGKYELLTSAN
Sequence Length
308
Applicable Applications for anti-GTF2H3 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 92%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human GTF2H3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-GTF2H3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:2500Positive Control: Jurkat cell lysateGTF2H3 is supported by BioGPS gene expression data to be expressed in Jurkat)

Rabbit Anti-GTF2H3 Polyclonal Antibody – Cat# AAA197170 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-GTF2H3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:2500Positive Control: Jurkat cell lysateGTF2H3 is supported by BioGPS gene expression data to be expressed in Jurkat)

IHC (Immunohiostchemistry)

(Rabbit Anti-GTF2H3 antibodyParaffin Embedded Tissue: Human Heartcell Cellular Data: cardiac cellAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Rabbit Anti-GTF2H3 Polyclonal Antibody – Cat# AAA197170 – IHC (Immunohiostchemistry) IHC (Immunohiostchemistry) (Rabbit Anti-GTF2H3 antibodyParaffin Embedded Tissue: Human Heartcell Cellular Data: cardiac cellAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

IHC (Immunohistochemistry)

(HumanMuscle)

Rabbit Anti-GTF2H3 Polyclonal Antibody – Cat# AAA197170 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (HumanMuscle)
Related Product Information for anti-GTF2H3 antibody
This is a rabbit polyclonal antibody against GTranscription Factor Antibodies2H3. It was validated on Western Blot and immunohistochemistry

Target Description: GTranscription Factor Antibodies2H3 interacts with HIV-1 Tat as a component of the HIV-1 transcription pre-initiation complex, but is released from the elongation complex which includes P-TEFb. It synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34kDa
NCBI Official Full Name
general transcription factor IIH subunit 3 isoform a
NCBI Official Synonym Full Names
general transcription factor IIH subunit 3
NCBI Official Symbol
GTF2H3
NCBI Official Synonym Symbols
P34; BTF2; TFB4; TFIIH
NCBI Protein Information
general transcription factor IIH subunit 3
UniProt Protein Name
General transcription factor IIH subunit 3
UniProt Gene Name
GTF2H3
UniProt Synonym Gene Names
BTF2 p34
UniProt Entry Name
TF2H3_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The GTF2H3 gtf2h3 (Catalog #AAA197170) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GTF2H3 antibody - N-terminal region reacts with Cow, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GTF2H3 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the GTF2H3 gtf2h3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VIASHIQESR FLYPGKNGRL GDFFGDPGNP PEFNPSGSKD GKYELLTSAN. It is sometimes possible for the material contained within the vial of "GTF2H3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.