Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-GTF2H2 Polyclonal Antibody – Cat# AAA201784 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-GTF2H2 Antibody Titration: 1 ug/mlPositive Control: Jurkat cell lysateGTF2H2 is supported by BioGPS gene expression data to be expressed in Jurkat)

General Transcription Factor IIH Subunit 2 Isoform A (GTF2H2) Antibody – Rabbit Polyclonal

GTF2H2 antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
GTF2H2; p44; BTF2; TFIIH; BTF2P44; T-BTF2P44
Reactivity
Dog, Horse, Human, Mouse, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
GTF2H2, Antibody; GTF2H2 antibody - C-terminal region; anti-GTF2H2 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Dog, Horse, Human, Mouse, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CELPVECKICGLTLVSAPHLARSYHHLFPLDAFQEIPLEEYNGERFCYGC
Sequence Length
395
Applicable Applications for anti-GTF2H2 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Dog: 92%; Horse: 92%; Human: 100%; Mouse: 85%; Zebrafish: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human GTF2H2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-GTF2H2 Antibody Titration: 1 ug/mlPositive Control: Jurkat cell lysateGTF2H2 is supported by BioGPS gene expression data to be expressed in Jurkat)

Rabbit Anti-GTF2H2 Polyclonal Antibody – Cat# AAA201784 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-GTF2H2 Antibody Titration: 1 ug/mlPositive Control: Jurkat cell lysateGTF2H2 is supported by BioGPS gene expression data to be expressed in Jurkat)

WB (Western Blot)

(Host: RabbitTarget Name: GTF2H2Sample Tissue: Human 293TAntibody Dilution: 1.0ug/ml)

Rabbit Anti-GTF2H2 Polyclonal Antibody – Cat# AAA201784 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: GTF2H2Sample Tissue: Human 293TAntibody Dilution: 1.0ug/ml)

IHC (Immunohistochemistry)

(Human Lung)

Rabbit Anti-GTF2H2 Polyclonal Antibody – Cat# AAA201784 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Human Lung)
Related Product Information for anti-GTF2H2 antibody
This is a rabbit polyclonal antibody against GTF2H2. It was validated on Western Blot

Target Description: GTF2 is encoded by a gene that is part of a 500 kb inverted duplication on chromosome 5q13. This duplicated region contains at least four genes and repetitive elements which make it prone to rearrangements and deletions. The repetitiveness and complexity of the sequence have also caused difficulty in determining the organization of this genomic region. This gene is within the telomeric copy of the duplication. Deletion of this gene sometimes accompanies deletion of the neighboring SMN1 gene in spinal muscular atrophy (SMA) patients but it is unclear if deletion of this gene contributes to the SMA phenotype. This gene encodes the 44 kDa subunit of RNA polymerase II transcription initiation factor IIH which is involved in basal transcription and nucleotide excision repair. Transcript variants for this gene have been described, but their full length nature has not been determined. A second copy of this gene within the centromeric copy of the duplication has been described in the literature. It is reported to be different by either two or four base pairs; however, no sequence data is currently available for the centromeric copy of the gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44kDa
NCBI Official Full Name
general transcription factor IIH subunit 2 isoform a
NCBI Official Synonym Full Names
general transcription factor IIH subunit 2
NCBI Official Symbol
GTF2H2
NCBI Official Synonym Symbols
p44; BTF2; TFIIH; BTF2P44; T-BTF2P44
NCBI Protein Information
general transcription factor IIH subunit 2
UniProt Protein Name
General transcription factor IIH subunit 2
UniProt Gene Name
GTF2H2
UniProt Synonym Gene Names
BTF2P44; BTF2 p44
UniProt Entry Name
TF2H2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The GTF2H2 gtf2h2 (Catalog #AAA201784) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GTF2H2 antibody - C-terminal region reacts with Dog, Horse, Human, Mouse, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's GTF2H2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the GTF2H2 gtf2h2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CELPVECKIC GLTLVSAPHL ARSYHHLFPL DAFQEIPLEE YNGERFCYGC. It is sometimes possible for the material contained within the vial of "GTF2H2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.