Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-GSTM2 Polyclonal Antibody – Cat# AAA198998 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-GSTM2 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Liver)

Glutathione S-Transferase Mu 2 Isoform 1 (GSTM2) Antibody – Rabbit Polyclonal

GSTM2 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
GSTM2; GST4; GSTM; GTHMUS; GSTM2-2
Reactivity
Human, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
GSTM2, Antibody; GSTM2 antibody - N-terminal region; anti-GSTM2 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Human, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TQSNAILRYIARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDF
Sequence Length
218
Applicable Applications for anti-GSTM2 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Human: 100%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human GSTM2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-GSTM2 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Liver)

Rabbit Anti-GSTM2 Polyclonal Antibody – Cat# AAA198998 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-GSTM2 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Liver)

WB (Western Blot)

(Host: RabbitTarget Name: GSTM2Sample Tissue: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

Rabbit Anti-GSTM2 Polyclonal Antibody – Cat# AAA198998 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: GSTM2Sample Tissue: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

IHC (Immunohiostchemistry)

(Rabbit Anti-GSTM2 AntibodyParaffin Embedded Tissue: Human MuscleCellular Data: Skeletal muscle cellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Rabbit Anti-GSTM2 Polyclonal Antibody – Cat# AAA198998 – IHC (Immunohiostchemistry) IHC (Immunohiostchemistry) (Rabbit Anti-GSTM2 AntibodyParaffin Embedded Tissue: Human MuscleCellular Data: Skeletal muscle cellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

IHC (Immunohistochemistry)

(Immunohistochemistry with Human Skeletal Muscle lysate tissue at an antibody concentration of 5.0ug/ml using anti-GSTM2 antibody)

Rabbit Anti-GSTM2 Polyclonal Antibody – Cat# AAA198998 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Immunohistochemistry with Human Skeletal Muscle lysate tissue at an antibody concentration of 5.0ug/ml using anti-GSTM2 antibody)
Related Product Information for anti-GSTM2 antibody
This is a rabbit polyclonal antibody against GSTM2. It was validated on Western Blot and immunohistochemistry

Target Description: At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. GSTM2 is a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione.Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding the mu class of enzymes are organized in a gene cluster on chromosome 1p13.3 and are known to be highly polymorphic. These genetic variations can change an individual's susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of certain drugs.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26kDa
NCBI Official Full Name
glutathione S-transferase Mu 2 isoform 1
NCBI Official Synonym Full Names
glutathione S-transferase mu 2
NCBI Official Symbol
GSTM2
NCBI Official Synonym Symbols
GST4; GSTM; GTHMUS; GSTM2-2
NCBI Protein Information
glutathione S-transferase Mu 2
UniProt Protein Name
Glutathione S-transferase Mu 2
UniProt Gene Name
GSTM2
UniProt Synonym Gene Names
GST4
UniProt Entry Name
GSTM2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The GSTM2 gstm2 (Catalog #AAA198998) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GSTM2 antibody - N-terminal region reacts with Human, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's GSTM2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the GSTM2 gstm2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TQSNAILRYI ARKHNLCGES EKEQIREDIL ENQFMDSRMQ LAKLCYDPDF. It is sometimes possible for the material contained within the vial of "GSTM2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.