Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA23553_WB10.jpg WB (Western Blot) (WB Suggested Anti-GSR Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Hela cell lysate)

Rabbit GSR Polyclonal Antibody | anti-GSR antibody

GSR antibody - N-terminal region

Gene Names
GSR; GR; HEL-75; HEL-S-122m
Reactivity
Tested Reactivity: Human, Mouse, Zebrafish
Predicted Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
GSR, Antibody; GSR antibody - N-terminal region; anti-GSR antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Tested Reactivity: Human, Mouse, Zebrafish
Predicted Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml (varies by lot)
Sequence
PTIEVSGKKYTAPHILIATGGMPSTPHESQIPGASLGITSDGFFQLEELP
Applicable Applications for anti-GSR antibody
Immunohistchemistry (IHC), Western Blot (WB)
Protein Size (# AA)
522 amino acids
Protein Interactions
SUMO1; CNDP2; GINS2; PROSC; AHSA1; NDRG1; DDX39A; NAMPT; KYNU; DDX39B; RPS6KA1; PEPD; MVD; LDHA; HSPD1; GBP2; EEF2; ADSS; C11orf49; UBC; FOLR1; ISG15; ELAVL1; SUMO4; PJA1; OCM; GSR;
Preparation and Storage
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-GSR Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Hela cell lysate)

product-image-AAA23553_WB10.jpg WB (Western Blot) (WB Suggested Anti-GSR Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Hela cell lysate)

WB (Western Blot)

(WB Suggested Anti-GSR AntibodyPositive Control: Lane 1: 10ug untreated zebrafish head lysate Lane 2: 10ug 3hr H2O2 treated zebrafish head lysate Lane 3: 10ug 6hr H2O2 treated zebrafish head lysatePrimary Antibody Dilution : 1:1000Secondary Antibody : Anti rabbit-HRPSecondry Antibody Dilution : 1:10,000Submitted by: Dr. Yuk Fai Leung, Purdue University)

product-image-AAA23553_WB9.jpg WB (Western Blot) (WB Suggested Anti-GSR AntibodyPositive Control: Lane 1: 10ug untreated zebrafish head lysate Lane 2: 10ug 3hr H2O2 treated zebrafish head lysate Lane 3: 10ug 6hr H2O2 treated zebrafish head lysatePrimary Antibody Dilution : 1:1000Secondary Antibody : Anti rabbit-HRPSecondry Antibody Dilution : 1:10,000Submitted by: Dr. Yuk Fai Leung, Purdue University)

WB (Western Blot)

(Lanes:1: 40ug mouse heart lysate, 2: 40ug mouse skeletal muscle lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:10000Gene Name:GSRSubmitted by:Anonymous)

product-image-AAA23553_WB8.jpg WB (Western Blot) (Lanes:1: 40ug mouse heart lysate, 2: 40ug mouse skeletal muscle lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:10000Gene Name:GSRSubmitted by:Anonymous)

WB (Western Blot)

(Host: RabbitTarget Name: WT1Sample Type: 721_BAntibody Dilution: 1.0ug/mlGSR is supported by BioGPS gene expression data to be expressed in 721_B)

product-image-AAA23553_WB7.jpg WB (Western Blot) (Host: RabbitTarget Name: WT1Sample Type: 721_BAntibody Dilution: 1.0ug/mlGSR is supported by BioGPS gene expression data to be expressed in 721_B)

WB (Western Blot)

(Host: RabbitTarget Name: NSUN6Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

product-image-AAA23553_WB6.jpg WB (Western Blot) (Host: RabbitTarget Name: NSUN6Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: GSRSample Tissue: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

product-image-AAA23553_WB5.jpg WB (Western Blot) (Host: RabbitTarget Name: GSRSample Tissue: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: FAM46CSample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

product-image-AAA23553_WB4.jpg WB (Western Blot) (Host: RabbitTarget Name: FAM46CSample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: EGFL8Sample Type: HepG2Antibody Dilution: 1.0ug/mlGSR is supported by BioGPS gene expression data to be expressed in HepG2)

product-image-AAA23553_WB3.jpg WB (Western Blot) (Host: RabbitTarget Name: EGFL8Sample Type: HepG2Antibody Dilution: 1.0ug/mlGSR is supported by BioGPS gene expression data to be expressed in HepG2)

WB (Western Blot)

(Host: RabbitTarget Name: CHADSample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

product-image-AAA23553_WB2.jpg WB (Western Blot) (Host: RabbitTarget Name: CHADSample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

IHC (Immunohistochemistry)

(Rabbit Anti-GSR AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial TissueObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

product-image-AAA23553_IHC.jpg IHC (Immunohistochemistry) (Rabbit Anti-GSR AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial TissueObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-GSR antibody
GSR belongs to the class-I pyridine nucleotide-disulfide oxidoreductase family. It maintains high levels of reduced glutathione in the cytosol. Both glutathione and glutathione reductase are inducible by D3T, and that upregulation of GSH biosynthesis underlies D3T-mediated cytoprotection against ROS/RNS-elicited injury to human vascular smooth muscle cells.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56kDa
NCBI Official Full Name
glutathione reductase, mitochondrial isoform 1
NCBI Official Synonym Full Names
glutathione-disulfide reductase
NCBI Official Symbol
GSR
NCBI Official Synonym Symbols
GR; HEL-75; HEL-S-122m
NCBI Protein Information
glutathione reductase, mitochondrial
UniProt Protein Name
Glutathione reductase, mitochondrial
UniProt Gene Name
GSR
UniProt Synonym Gene Names
GLUR; GRD1; GR; GRase
UniProt Entry Name
GSHR_HUMAN

Similar Products

Product Notes

The GSR gsr (Catalog #AAA23553) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GSR antibody - N-terminal region reacts with Tested Reactivity: Human, Mouse, Zebrafish Predicted Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GSR can be used in a range of immunoassay formats including, but not limited to, Immunohistchemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the GSR gsr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: PTIEVSGKKY TAPHILIATG GMPSTPHESQ IPGASLGITS DGFFQLEELP. It is sometimes possible for the material contained within the vial of "GSR, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.