Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-GRIN2A Polyclonal Antibody – Cat# AAA197909 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-GRIN2A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Muscle)

Glutamate Receptor Ionotropic, NMDA 2A Isoform 1 (GRIN2A) Antibody – Rabbit Polyclonal

GRIN2A antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
GRIN2A; LKS; EPND; FESD; NR2A; GluN2A; NMDAR2A
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
GRIN2A, Antibody; GRIN2A antibody - middle region; anti-GRIN2A antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DKIYTIDGEKEPGFHLDPPQFVENVTLPENVDFPDPYQDPSENFRKGDST
Sequence Length
1464
Applicable Applications for anti-GRIN2A antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 77%; Dog: 93%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 79%; Rat: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human GRIN2A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-GRIN2A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Muscle)

Rabbit Anti-GRIN2A Polyclonal Antibody – Cat# AAA197909 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-GRIN2A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Muscle)

IHC (Immunohistochemistry)

(Sample Type :Rat Hippocampal Neurons - 14DIVPrimary Antibody Dilution :1:200Secondary Antibody :Anti-rabbit-Cy3Secondary Antibody Dilution :1:500Color/Signal Descriptions :Green: GFP Red: NR2a Yellow: VGLUT12Gene Name :GRIN2ASubmitted by :Dan Fowler - University of Oregon, Institute of Neuroscience)

Rabbit Anti-GRIN2A Polyclonal Antibody – Cat# AAA197909 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Sample Type :Rat Hippocampal Neurons - 14DIVPrimary Antibody Dilution :1:200Secondary Antibody :Anti-rabbit-Cy3Secondary Antibody Dilution :1:500Color/Signal Descriptions :Green: GFP Red: NR2a Yellow: VGLUT12Gene Name :GRIN2ASubmitted by :Dan Fowler - University of Oregon, Institute of Neuroscience)
Related Product Information for anti-GRIN2A antibody
This is a rabbit polyclonal antibody against GRIN2A. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: N-methyl-D-aspartate (NMDA) receptors are a class of ionotropic glutamate-gated ion channels. These receptors have been shown to be involved in long-term potentiation, an activity-dependent increase in the efficiency of synaptic transmission thought to underlie certain kinds of memory and learning. NMDA receptor channels are heteromers composed of the key receptor subunit NMDAR1 (GRIN1) and 1 or more of the 4 NMDAR2 subunits: NMDAR2A (GRIN2A), NMDAR2B (GRIN2B), NMDAR2C (GRIN2C) and NMDAR2D (GRIN2D).N-methyl-D-aspartate (NMDA) receptors are a class of ionotropic glutamate receptors. NMDA channel has been shown to be involved in long-term potentiation, an activity-dependent increase in the efficiency of synaptic transmission thought to underlie certain kinds of memory and learning. NMDA receptor channels are heteromers composed of the key receptor subunit NMDAR1 (GRIN1) and 1 or more of the 4 NMDAR2 subunits: NMDAR2A (GRIN2A), NMDAR2B (GRIN2B), NMDAR2C (GRIN2C), and NMDAR2D (GRIN2D). Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
163kDa
NCBI Official Full Name
glutamate receptor ionotropic, NMDA 2A isoform 1
NCBI Official Synonym Full Names
glutamate ionotropic receptor NMDA type subunit 2A
NCBI Official Symbol
GRIN2A
NCBI Official Synonym Symbols
LKS; EPND; FESD; NR2A; GluN2A; NMDAR2A
NCBI Protein Information
glutamate receptor ionotropic, NMDA 2A
UniProt Protein Name
Glutamate receptor ionotropic, NMDA 2A
UniProt Gene Name
GRIN2A
UniProt Synonym Gene Names
NMDAR2A; GluN2A; NMDAR2A; NR2A; hNR2A
UniProt Entry Name
NMDE1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The GRIN2A grin2a (Catalog #AAA197909) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GRIN2A antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GRIN2A can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the GRIN2A grin2a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DKIYTIDGEK EPGFHLDPPQ FVENVTLPEN VDFPDPYQDP SENFRKGDST. It is sometimes possible for the material contained within the vial of "GRIN2A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.