Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA147852_WB15.jpg WB (Western Blot) (Western Blot: Sample: Recombinant GFP.)

Rabbit anti-General Green Fluorescent Protein (GFP) Polyclonal Antibody | anti-GFP antibody

Green Fluorescent Protein (GFP) Polyclonal Antibody

★ ★ ★ ★ ★
Average rating 0.0
No ratings yet
Reactivity
General
Applications
Immunoprecipitation, Immunocytochemistry, Immunohistochemistry, Western Blot
Purity
Antigen-specific affinity chromatography followed by Protein A affinity chromatography
Synonyms
Green Fluorescent Protein (GFP), Antibody; Green Fluorescent Protein (GFP) Polyclonal Antibody; Polyclonal Antibody to Green Fluorescent Protein (GFP); anti-GFP antibody
Ordering
Host
Rabbit
Reactivity
General
Clonality
Polyclonal
Purity/Purification
Antigen-specific affinity chromatography followed by Protein A affinity chromatography
Form/Format
Supplied as solution form in 0.01M PBS, pH7.4, containing 0.05% Proclin-300, 50% glycerol.
Concentration
1mg/ml (varies by lot)
Applicable Applications for anti-GFP antibody
IP (Immunoprecipitation), ICC (Immunocytochemistry), IHC (Immunohistochemistry), WB (Western Blot)
Source
Polyclonal antibody preparation
Traits
Liquid
Immunogen
Recombinant GFP (KETWWETWWTEWSQPKKKRKG-Met1~Lys238myc-FLAG tag) expressed in E.coli ( ).
Preparation and Storage
Storage:
Avoid repeated freeze/thaw cycles.
Store at 4 degree C for frequent use.
Aliquot and store at -20 degree C for 24 months.

Stability Test:
thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37 degree C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.

WB (Western Blot)

(Western Blot: Sample: Recombinant GFP.)

product-image-AAA147852_WB15.jpg WB (Western Blot) (Western Blot: Sample: Recombinant GFP.)

NCBI and Uniprot Product Information

NCBI GI #
UniProt Accession #
NCBI Official Full Name
Green fluorescent protein
UniProt Protein Name
Green fluorescent protein
UniProt Gene Name
GFP

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The GFP gfp (Catalog #AAA147852) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Green Fluorescent Protein (GFP) Polyclonal Antibody reacts with General and may cross-react with other species as described in the data sheet. AAA Biotech's Green Fluorescent Protein (GFP) can be used in a range of immunoassay formats including, but not limited to, IP (Immunoprecipitation), ICC (Immunocytochemistry), IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the GFP gfp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Green Fluorescent Protein (GFP), Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request Manual

Please complete the form below and a representative will contact you as soon as possible.

Request Quote

Please complete the form below and a representative will contact you as soon as possible.