Retinoic Acid-Induced Protein 3 (GPRC5A) Antibody – Rabbit Polyclonal
GPCR5A antibody - C-terminal region
Gene Names
GPRC5A; RAI3; TIG1; RAIG1; GPCR5A; PEIG-1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GPCR5A, Antibody; GPCR5A antibody - C-terminal region; anti-GPRC5A antibody
Product Overview
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SQEEITQGFEETGDTLYAPYSTHFQLQNQPPQKEFSIPRAHAWPSPYKDY
Sequence Length
357
Applicable Applications for anti-GPRC5A antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 91%; Horse: 85%; Human: 100%; Mouse: 93%; Pig: 92%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human GPCR5A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-GPRC5A antibody
This is a rabbit polyclonal antibody against GPCR5A. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: GPCR5A is a member of the type 3 G protein-coupling receptor family, characterized by the signature 7-transmembrane domain motif. The protein may be involved in interaction between retinoid acid and G protein signalling pathways. Retinoic acid plays a critical role in development, cellular growth, and differentiation. Its gene may play a role in embryonic development and epithelial cell differentiation.This gene encodes a member of the type 3 G protein-coupling receptor family, characterized by the signature 7-transmembrane domain motif. The encoded protein may be involved in interaction between retinoid acid and G protein signalling pathways. Retinoic acid plays a critical role in development, cellular growth, and differentiation. This gene may play a role in embryonic development and epithelial cell differentiation.
Target Description: GPCR5A is a member of the type 3 G protein-coupling receptor family, characterized by the signature 7-transmembrane domain motif. The protein may be involved in interaction between retinoid acid and G protein signalling pathways. Retinoic acid plays a critical role in development, cellular growth, and differentiation. Its gene may play a role in embryonic development and epithelial cell differentiation.This gene encodes a member of the type 3 G protein-coupling receptor family, characterized by the signature 7-transmembrane domain motif. The encoded protein may be involved in interaction between retinoid acid and G protein signalling pathways. Retinoic acid plays a critical role in development, cellular growth, and differentiation. This gene may play a role in embryonic development and epithelial cell differentiation.
Product Categories/Family for anti-GPRC5A antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39kDa
NCBI Official Full Name
retinoic acid-induced protein 3
NCBI Official Synonym Full Names
G protein-coupled receptor class C group 5 member A
NCBI Official Symbol
GPRC5A
NCBI Official Synonym Symbols
RAI3; TIG1; RAIG1; GPCR5A; PEIG-1
NCBI Protein Information
retinoic acid-induced protein 3
UniProt Protein Name
Retinoic acid-induced protein 3
UniProt Gene Name
GPRC5A
UniProt Synonym Gene Names
GPCR5A; RAI3; RAIG1; RAIG-1
UniProt Entry Name
RAI3_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Additional Details
Product Notes
The GPRC5A gprc5a (Catalog #AAA198934) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GPCR5A antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GPCR5A can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the GPRC5A gprc5a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SQEEITQGFE ETGDTLYAPY STHFQLQNQP PQKEFSIPRA HAWPSPYKDY. It is sometimes possible for the material contained within the vial of "GPCR5A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
