Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-GNAT3 Polyclonal Antibody – Cat# AAA201557 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: GNAT3Sample Tissue: Human 293T Whole CellAntibody Dilution: 1.0ug/ml)

Guanine Nucleotide-Binding Protein G(T) Subunit Alpha-3 (GNAT3) Antibody – Rabbit Polyclonal

GNAT3 Antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
GNAT3; GDCA
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
GNAT3, Antibody; GNAT3 Antibody - middle region; anti-GNAT3 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ICFPEYTGPNTFEDAGNYIKNQFLDLNLKKEDKEIYSHMTCATDTQNVKF
Sequence Length
354
Applicable Applications for anti-GNAT3 antibody
WB (Western Blot)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human GNAT3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Host: RabbitTarget Name: GNAT3Sample Tissue: Human 293T Whole CellAntibody Dilution: 1.0ug/ml)

Rabbit Anti-GNAT3 Polyclonal Antibody – Cat# AAA201557 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: GNAT3Sample Tissue: Human 293T Whole CellAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: MouseTarget Name: GNAT3Sample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)

Rabbit Anti-GNAT3 Polyclonal Antibody – Cat# AAA201557 – WB (Western Blot) WB (Western Blot) (Host: MouseTarget Name: GNAT3Sample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)
Related Product Information for anti-GNAT3 antibody
Sweet, bitter, and umami tastes are transmitted from taste receptors by a specific guanine nucleotide binding protein. The protein encoded by this gene is the alpha subunit of this heterotrimeric G protein, which is found not only in the oral epithelium but also in gut tissues. Variations in this gene have been linked to metabolic syndrome.
Product Categories/Family for anti-GNAT3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40 kDa
NCBI Official Full Name
guanine nucleotide-binding protein G(t) subunit alpha-3
NCBI Official Synonym Full Names
G protein subunit alpha transducin 3
NCBI Official Symbol
GNAT3
NCBI Official Synonym Symbols
GDCA
NCBI Protein Information
guanine nucleotide-binding protein G(t) subunit alpha-3
UniProt Protein Name
Guanine nucleotide-binding protein G(t) subunit alpha-3
UniProt Gene Name
GNAT3
UniProt Entry Name
GNAT3_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The GNAT3 gnat3 (Catalog #AAA201557) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GNAT3 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GNAT3 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the GNAT3 gnat3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ICFPEYTGPN TFEDAGNYIK NQFLDLNLKK EDKEIYSHMT CATDTQNVKF. It is sometimes possible for the material contained within the vial of "GNAT3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.