Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-GNAS Polyclonal Antibody – Cat# AAA198989 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-GNAS Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysateThere is BioGPS gene expression data showing that GNAS is expressed in Jurkat)

Protein GNAS Isoform GNASL (GNAS) Antibody – Rabbit Polyclonal

GNAS antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
GNAS; AHO; GSA; GSP; POH; GPSA; NESP; SCG6; SgVI; GNAS1; PITA3; C20orf45
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
GNAS, Antibody; GNAS antibody - N-terminal region; anti-GNAS antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEGVRACYERSNEYQ
Sequence Length
394
Applicable Applications for anti-GNAS antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human GNAS
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-GNAS Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysateThere is BioGPS gene expression data showing that GNAS is expressed in Jurkat)

Rabbit Anti-GNAS Polyclonal Antibody – Cat# AAA198989 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-GNAS Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysateThere is BioGPS gene expression data showing that GNAS is expressed in Jurkat)

WB (Western Blot)

(WB Suggested Anti-GNAS antibody Titration: 1 ug/mLSample Type: Human MCF7)

Rabbit Anti-GNAS Polyclonal Antibody – Cat# AAA198989 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-GNAS antibody Titration: 1 ug/mLSample Type: Human MCF7)

WB (Western Blot)

(Sample Type: human thryoidSample Type: Nthy-ori cell lysate (50ug)Primary Dilution: 1:1000Secondary Antibody: anti-rabbit HRPSecondary Dilution: 1:2000Image Submitted By: Anonymous)

Rabbit Anti-GNAS Polyclonal Antibody – Cat# AAA198989 – WB (Western Blot) WB (Western Blot) (Sample Type: human thryoidSample Type: Nthy-ori cell lysate (50ug)Primary Dilution: 1:1000Secondary Antibody: anti-rabbit HRPSecondary Dilution: 1:2000Image Submitted By: Anonymous)
Related Product Information for anti-GNAS antibody
This is a rabbit polyclonal antibody against GNAS. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Mutations in GNAS gene result in pseudohypoparathyroidism type 1a, pseudohypoparathyroidism type 1b, Albright hereditary osteodystrophy, pseudopseudohypoparathyroidism, McCune-Albright syndrome, progressive osseus heteroplasia, polyostotic fibrous dysplasia of bone, and some pituitary tumors.This gene has a highly complex imprinted expression pattern. It encodes maternally, paternally, and biallelically expressed proteins which are derived from alternatively spliced transcripts with alternate 5' exons. Each of the upstream exons is within a differentially methylated region, commonly found in imprinted genes. However, the close proximity (14 kb) of two oppositely expressed promoter regions is unusual. In addition, one of the alternate 5' exons introduces a frameshift relative to the other transcripts, resulting in one isoform which is structurally unrelated to the others. An antisense transcript exists, and may regulate imprinting in this region. Mutations in this gene result in pseudohypoparathyroidism type 1a (PHP1a), which has an atypical autosomal dominant inheritance pattern requiring maternal transmission for full penetrance. There are RefSeqs representing four transcript variants of this gene. Other transcript variants including four additional exons have been described; however, their full length sequences have not been determined.This locus has a highly complex imprinted expression pattern. It gives rise to maternally, paternally, and biallelically expressed transcripts that are derived from four alternative promoters and 5' exons. Some transcripts contains a differentially methylated region (DMR) at their 5' exons, and this DMR is commonly found in imprinted genes and correlates with transcript expression. An antisense transcript exists, and this antisense transcript and one of the transcripts are paternally expressed, produce noncoding RNAs, and may regulate imprinting in this region. In addition, one of the transcripts contains a second overlapping ORF, which encodes a structurally unrelated protein - Alex. Alternative splicing of downstream exons is also observed, which results in different forms of the stimulatory G-protein alpha subunit, a key element of the classical signal transduction pathway linking receptor-ligand interactions with the activation of adenylyl cyclase and a variety of cellular reponses. Multiple transcript variants have been found for this gene, but the full-length nature and/or biological validity of some variants have not been determined. Mutations in this gene result in pseudohypoparathyroidism type 1a, pseudohypoparathyroidism type 1b, Albright hereditary osteodystrophy, pseudopseudohypoparathyroidism, McCune-Albright syndrome, progressive osseus heteroplasia, polyostotic fibrous dysplasia of bone, and some pituitary tumors.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46kDa
NCBI Official Full Name
protein GNAS isoform GNASL
NCBI Official Synonym Full Names
GNAS complex locus
NCBI Official Symbol
GNAS
NCBI Official Synonym Symbols
AHO; GSA; GSP; POH; GPSA; NESP; SCG6; SgVI; GNAS1; PITA3; C20orf45
NCBI Protein Information
protein ALEX; protein GNAS; protein SCG6 (secretogranin VI)
UniProt Protein Name
Guanine nucleotide-binding protein G(s) subunit alpha isoforms short
UniProt Gene Name
GNAS
UniProt Synonym Gene Names
GNAS1; GSP
UniProt Entry Name
GNAS2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The GNAS gnas (Catalog #AAA198989) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GNAS antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GNAS can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the GNAS gnas for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NPENQFRVDY ILSVMNVPDF DFPPEFYEHA KALWEDEGVR ACYERSNEYQ. It is sometimes possible for the material contained within the vial of "GNAS, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.