Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Anti-GNAQ Polyclonal Antibody – Cat# AAA46422 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Anti- GNAQ Picoband antibody, AAA46422, IHC(P)IHC(P): Human Prostatic Cancer Tissue)

Guanine Nucleotide-Binding Protein G(Q) Subunit Alpha (GNAQ) Antibody – Polyclonal

Anti-GNAQ Antibody

Average rating 0.0
No ratings yet
Gene Names
GNAQ; GAQ; SWS; CMC1; G-ALPHA-q
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Immunogen Affinity Purified
Synonyms
GNAQ, Antibody; Anti-GNAQ Antibody; Guanine nucleotide-binding protein G(q) subunit alpha; CMC1; G alpha Q; G protein alpha Q; G-ALPHA-q; GAQ; GNAQ; GNAQ_HUMAN; guanine nucleotide binding protein (G protein), q polypeptide; Guanine nucleotide binding protein alpha q; guanine nucleotide binding protein G protein q polypeptide; Guanine nucleotide binding protein G q subunit alpha; Guanine nucleotide-binding protein alpha-q; SWS; anti-GNAQ antibody
Ordering

Product Overview

Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
359
Applicable Applications for anti-GNAQ antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human GNAQ (102-138aa KYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWND), identical to the related mouse and rat sequences.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohistochemistry)

(Anti- GNAQ Picoband antibody, AAA46422, IHC(P)IHC(P): Human Prostatic Cancer Tissue)

Anti-GNAQ Polyclonal Antibody – Cat# AAA46422 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Anti- GNAQ Picoband antibody, AAA46422, IHC(P)IHC(P): Human Prostatic Cancer Tissue)

IHC (Immunohistochemisry)

(Anti- GNAQ Picoband antibody, AAA46422, IHC(P)IHC(P): Rat Ovary Tissue)

Anti-GNAQ Polyclonal Antibody – Cat# AAA46422 – IHC (Immunohistochemisry) IHC (Immunohistochemisry) (Anti- GNAQ Picoband antibody, AAA46422, IHC(P)IHC(P): Rat Ovary Tissue)

IHC (Immunohiostchemistry)

(Anti- GNAQ Picoband antibody, AAA46422, IHC(P)IHC(P): Mouse Testis Tissue)

Anti-GNAQ Polyclonal Antibody – Cat# AAA46422 – IHC (Immunohiostchemistry) IHC (Immunohiostchemistry) (Anti- GNAQ Picoband antibody, AAA46422, IHC(P)IHC(P): Mouse Testis Tissue)

WB (Western Blot)

(Anti- GNAQ Picoband antibody, AAA46422, Western blottingAll lanes: Anti GNAQ (AAA46422) at 0.5ug/mlLane 1: Rat Ovary Tissue Lysate at 50ugLane 2: Rat Testis Tissue Lysate at 50ugLane 3: Mouse Testis Tissue Lysate at 50ugLane 4: 22RV1 Whole Cell Lysate at 40ugLane 5: SKOV Whole Cell Lysate at 40ugPredicted bind size: 42KDObserved bind size: 42KD)

Anti-GNAQ Polyclonal Antibody – Cat# AAA46422 – WB (Western Blot) WB (Western Blot) (Anti- GNAQ Picoband antibody, AAA46422, Western blottingAll lanes: Anti GNAQ (AAA46422) at 0.5ug/mlLane 1: Rat Ovary Tissue Lysate at 50ugLane 2: Rat Testis Tissue Lysate at 50ugLane 3: Mouse Testis Tissue Lysate at 50ugLane 4: 22RV1 Whole Cell Lysate at 40ugLane 5: SKOV Whole Cell Lysate at 40ugPredicted bind size: 42KDObserved bind size: 42KD)
Related Product Information for anti-GNAQ antibody
Description: Rabbit IgG polyclonal antibody for Guanine nucleotide-binding protein G(q) subunit alpha(GNAQ) detection. Tested with WB, IHC-P in Human;Rat;Mouse.

Background: Guanine nucleotide-binding protein G(q) subunit alpha is a protein that in humans is encoded by the GNAQ gene. Guanine nucleotide-binding proteins are a family of heterotrimeric proteins that couple cell surface, 7-transmembrane domain receptors to intracellular signaling pathways. Receptor activation catalyzes the exchange of GDP for GTP bound to the inactive G protein alpha subunit resulting in a conformational change and dissociation of the complex. The G protein alpha and beta-gamma subunits are capable of regulating various cellular effectors. Activation is terminated by a GTPase intrinsic to the G-alpha subunit. G-alpha-q is the alpha subunit of one of the heterotrimeric GTP-binding proteins that mediates stimulation of phospholipase C-beta. Mutations in this gene have been found associated to cases of Sturge-Weber syndrome and port-wine stains.
References
1. Dong Q, Shenker A, Way J, Haddad BR, Lin K, Hughes MR, McBride OW, Spiegel AM, Battey J (February 1997). "Molecular cloning of human G alpha q cDNA and chromosomal localization of the G alpha q gene (GNAQ) and a processed pseudogene".Genomics 30 (3): 470-75. 2. Shirley MD, Tang H, Gallione CJ, Baugher JD, Frelin LP, Cohen B, North PE, Marchuk DA, Comi AM, Pevsner J (May 23, 2013). "Sturge-Weber syndrome and port-wine stains caused by somatic mutation in GNAQ.". The New England Journal of Medicine368 (21): 1971-9.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42,142 Da
NCBI Official Full Name
guanine nucleotide-binding protein G(q) subunit alpha
NCBI Official Synonym Full Names
G protein subunit alpha q
NCBI Official Symbol
GNAQ
NCBI Official Synonym Symbols
GAQ; SWS; CMC1; G-ALPHA-q
NCBI Protein Information
guanine nucleotide-binding protein G(q) subunit alpha
UniProt Protein Name
Guanine nucleotide-binding protein G(q) subunit alpha
UniProt Gene Name
GNAQ
UniProt Synonym Gene Names
GAQ
UniProt Entry Name
GNAQ_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The GNAQ gnaq (Catalog #AAA46422) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-GNAQ Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GNAQ can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the GNAQ gnaq for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GNAQ, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.