Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-GLS Polyclonal Antibody – Cat# AAA200463 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-GLS Antibody Titration: 0.2-1 ug/mlPositive Control: ACHN cell lysateGLS is strongly supported by BioGPS gene expression data to be expressed in Human ACHN cells)

Glutaminase Kidney Isoform, Mitochondrial Isoform 1 (GLS) Antibody – Rabbit Polyclonal

GLS antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
GLS; GAC; GAM; KGA; GLS1; AAD20
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GLS, Antibody; GLS antibody - C-terminal region; anti-GLS antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VNPFPKDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQT
Sequence Length
669
Applicable Applications for anti-GLS antibody
WB (Western Blot)
Homology
Dog: 86%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 86%; Rabbit: 100%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the c terminal region of human GLS
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-GLS Antibody Titration: 0.2-1 ug/mlPositive Control: ACHN cell lysateGLS is strongly supported by BioGPS gene expression data to be expressed in Human ACHN cells)

Rabbit Anti-GLS Polyclonal Antibody – Cat# AAA200463 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-GLS Antibody Titration: 0.2-1 ug/mlPositive Control: ACHN cell lysateGLS is strongly supported by BioGPS gene expression data to be expressed in Human ACHN cells)

WB (Western Blot)

(Host: RabbitTarget Name: GLSSample Tissue: Human U937 Whole CellAntibody Dilution: 1ug/ml)

Rabbit Anti-GLS Polyclonal Antibody – Cat# AAA200463 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: GLSSample Tissue: Human U937 Whole CellAntibody Dilution: 1ug/ml)

WB (Western Blot)

(GLS antibody - C-terminal region validated by WB using Cortex/Kidney/Brain at 1:2000.)

Rabbit Anti-GLS Polyclonal Antibody – Cat# AAA200463 – WB (Western Blot) WB (Western Blot) (GLS antibody - C-terminal region validated by WB using Cortex/Kidney/Brain at 1:2000.)
Related Product Information for anti-GLS antibody
This is a rabbit polyclonal antibody against GLS. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Sahai (1983) [PubMed 6825316] demonstrated phosphate-activated glutaminase (EC 3.5.1.2) in human platelets. It is the major enzyme yielding glutamate from glutamine. Significance of the enzyme derives from its possible implication in behavior disturbances
Product Categories/Family for anti-GLS antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
73kDa
NCBI Official Full Name
glutaminase kidney isoform, mitochondrial isoform 1
NCBI Official Synonym Full Names
glutaminase
NCBI Official Symbol
GLS
NCBI Official Synonym Symbols
GAC; GAM; KGA; GLS1; AAD20
NCBI Protein Information
glutaminase kidney isoform, mitochondrial
UniProt Protein Name
Glutaminase kidney isoform, mitochondrial
UniProt Gene Name
GLS
UniProt Synonym Gene Names
GLS1; KIAA0838; GLS
UniProt Entry Name
GLSK_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The GLS gls (Catalog #AAA200463) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GLS antibody - C-terminal region reacts with Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GLS can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the GLS gls for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VNPFPKDRWN NTPMDEALHF GHHDVFKILQ EYQVQYTPQG DSDNGKENQT. It is sometimes possible for the material contained within the vial of "GLS, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.