Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-GFI1B Polyclonal Antibody – Cat# AAA197089 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-GFI1B Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)

Zinc Finger Protein Gfi-1B Isoform 1 (GFI1B) Antibody – Rabbit Polyclonal

GFI1B antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
GFI1B; BDPLT17; ZNF163B
Reactivity
Cow, Dog, Goat, Horse, Human, Mouse, Pig, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
GFI1B, Antibody; GFI1B antibody - N-terminal region; anti-GFI1B antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Dog, Goat, Horse, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MPRSFLVKSKMAHTYHQPRVQEDEPLWPPALTPVPRDQAPSNSPVLSTLF
Sequence Length
330
Applicable Applications for anti-GFI1B antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 83%; Dog: 100%; Goat: 83%; Horse: 100%; Human: 100%; Mouse: 83%; Pig: 93%; Rat: 82%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human GFI1B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-GFI1B Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)

Rabbit Anti-GFI1B Polyclonal Antibody – Cat# AAA197089 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-GFI1B Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)

IHC (Immunohiostchemistry)

(Rabbit Anti-GFI1B AntibodyParaffin Embedded Tissue: Human KidneyCellular Data: Epithelial cells of renal tubule and renal corpuscleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Rabbit Anti-GFI1B Polyclonal Antibody – Cat# AAA197089 – IHC (Immunohiostchemistry) IHC (Immunohiostchemistry) (Rabbit Anti-GFI1B AntibodyParaffin Embedded Tissue: Human KidneyCellular Data: Epithelial cells of renal tubule and renal corpuscleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

IHC (Immunohistochemistry)

(Rabbit Anti-GFI1B AntibodyParaffin Embedded Tissue: Human HeartCellular Data: Myocardial cellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Rabbit Anti-GFI1B Polyclonal Antibody – Cat# AAA197089 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Rabbit Anti-GFI1B AntibodyParaffin Embedded Tissue: Human HeartCellular Data: Myocardial cellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Related Product Information for anti-GFI1B antibody
This is a rabbit polyclonal antibody against GFI1B. It was validated on Western Blot and immunohistochemistry

Target Description: GFI1B acts in the late stage of erythroid differentiation as a transcriptional repressor. GATA-1 and NF-Y both contribute to erythroid-specific transcriptional activation of the Gfi-1B promoter. This zinc finger protein mediates erythroid expansion and has a role in normal erythropoiesis.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38kDa
NCBI Official Full Name
zinc finger protein Gfi-1b isoform 1
NCBI Official Synonym Full Names
growth factor independent 1B transcriptional repressor
NCBI Official Symbol
GFI1B
NCBI Official Synonym Symbols
BDPLT17; ZNF163B
NCBI Protein Information
zinc finger protein Gfi-1b
UniProt Protein Name
Zinc finger protein Gfi-1b
UniProt Gene Name
GFI1B
UniProt Entry Name
GFI1B_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The GFI1B gfi1b (Catalog #AAA197089) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GFI1B antibody - N-terminal region reacts with Cow, Dog, Goat, Horse, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GFI1B can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the GFI1B gfi1b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MPRSFLVKSK MAHTYHQPRV QEDEPLWPPA LTPVPRDQAP SNSPVLSTLF. It is sometimes possible for the material contained within the vial of "GFI1B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.