Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-GADD45A Polyclonal Antibody – Cat# AAA21309 – IHC (Immunohistchemistry) IHC (Immunohistchemistry) (GADD45A/GADD45 Antibody-Immunohistochemistry of paraffin-embedded human esophagus using GADD45A antibody at dilution of 1:100 (400x lens).)

Growth Arrest And DNA Damage-Inducible Protein GADD45 Alpha Isoform 1 (GADD45A) Antibody – Rabbit Polyclonal

GADD45A/GADD45 Rabbit anti-Human Polyclonal Antibody

Average rating 0.0
No ratings yet
Gene Names
GADD45A; DDIT1; GADD45
Reactivity
Mouse, Human
Applications
Immunofluorescence, Immunohistochemistry, Immunohistochemistry, Western Blot
Purity
Affinity purified
Synonyms
GADD45A/GADD45, Antibody; GADD45A/GADD45 Rabbit anti-Human Polyclonal Antibody; IHC-plus GADD45A/GADD45 Antibody; GADD45A; DDIT-1; DDIT1; GADD45; anti-GADD45A antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Mouse, Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Human GADD45A/GADD45
Purity/Purification
Affinity purified
Form/Format
PBS, pH7.3, 0.02% Sodium Azide, 50% Glycerol
Concentration
0.51mg/ml (varies by lot)
Applicable Applications for anti-GADD45A antibody
IF (Immunofluorescence), IHC (Immunohistochemistry), IHC (Immunohistochemistry), WB (Western Blot)
Application Notes
IHC-P: 1:200
WB: 1:500-1:2000
The predicted MW is 14kDa/18kDa, while the observed MW by Western blot was 18kDa.
Target
Human GADD45A/GADD45
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-165 of human GADD45A (NP_001915.1). MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLAADEDDDRDVALQIHFTLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPPDLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER
Conjugation
Unconjugated
Preparation and Storage
Store at -20 degree C. Avoid freeze-thaw cycles.

IHC (Immunohistchemistry)

(GADD45A/GADD45 Antibody-Immunohistochemistry of paraffin-embedded human esophagus using GADD45A antibody at dilution of 1:100 (400x lens).)

Rabbit Anti-GADD45A Polyclonal Antibody – Cat# AAA21309 – IHC (Immunohistchemistry) IHC (Immunohistchemistry) (GADD45A/GADD45 Antibody-Immunohistochemistry of paraffin-embedded human esophagus using GADD45A antibody at dilution of 1:100 (400x lens).)

IHC (Immunohistochemistry)

(GADD45A/GADD45 Antibody-Human Skin: Formalin-Fixed, Paraffin-Embedded (FFPE))

Rabbit Anti-GADD45A Polyclonal Antibody – Cat# AAA21309 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (GADD45A/GADD45 Antibody-Human Skin: Formalin-Fixed, Paraffin-Embedded (FFPE))

IHC (Immunohistochemistry)

(GADD45A/GADD45 Antibody-Human Spleen: Formalin-Fixed, Paraffin-Embedded (FFPE))

Rabbit Anti-GADD45A Polyclonal Antibody – Cat# AAA21309 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (GADD45A/GADD45 Antibody-Human Spleen: Formalin-Fixed, Paraffin-Embedded (FFPE))

WB (Western Blot)

(GADD45A/GADD45 Antibody-Western blot analysis of extracts of various cell lines, using GADD45A antibody.)

Rabbit Anti-GADD45A Polyclonal Antibody – Cat# AAA21309 – WB (Western Blot) WB (Western Blot) (GADD45A/GADD45 Antibody-Western blot analysis of extracts of various cell lines, using GADD45A antibody.)

WB (Western Blot)

(GADD45A/GADD45 Antibody-Western blot analysis of extracts of mouse liver, using GADD45A antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.)

Rabbit Anti-GADD45A Polyclonal Antibody – Cat# AAA21309 – WB (Western Blot) WB (Western Blot) (GADD45A/GADD45 Antibody-Western blot analysis of extracts of mouse liver, using GADD45A antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.)

ICC (Immunocytochemistry)

(GADD45A/GADD45 Antibody-Immunofluorescence analysis of A549 cells.)

Rabbit Anti-GADD45A Polyclonal Antibody – Cat# AAA21309 – ICC (Immunocytochemistry) ICC (Immunocytochemistry) (GADD45A/GADD45 Antibody-Immunofluorescence analysis of A549 cells.)
Related Product Information for anti-GADD45A antibody
GADD45 antibody is an unconjugated rabbit polyclonal antibody to GADD45 (GADD45A) from human. It is reactive with human and mouse. Validated for IF, IHC and WB. Tested on 20 paraffin-embedded human tissues.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18,336 Da
NCBI Official Full Name
growth arrest and DNA damage-inducible protein GADD45 alpha isoform 1
NCBI Official Synonym Full Names
growth arrest and DNA-damage-inducible, alpha
NCBI Official Symbol
GADD45A
NCBI Official Synonym Symbols
DDIT1; GADD45
NCBI Protein Information
growth arrest and DNA damage-inducible protein GADD45 alpha; DDIT-1; OTTHUMP00000010979; OTTHUMP00000010981; DNA damage-inducible transcript-1; DNA-damage-inducible transcript 1; DNA damage-inducible transcript 1 protein; growth arrest and DNA-damage-indu
UniProt Protein Name
Growth arrest and DNA damage-inducible protein GADD45 alpha
UniProt Gene Name
GADD45A
UniProt Synonym Gene Names
DDIT1; GADD45; DDIT-1
UniProt Entry Name
GA45A_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The GADD45A gadd45a (Catalog #AAA21309) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GADD45A/GADD45 Rabbit anti-Human Polyclonal Antibody reacts with Mouse, Human and may cross-react with other species as described in the data sheet. AAA Biotech's GADD45A/GADD45 can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), IHC (Immunohistochemistry), IHC (Immunohistochemistry), WB (Western Blot). IHC-P: 1:200 WB: 1:500-1:2000 The predicted MW is 14kDa/18kDa, while the observed MW by Western blot was 18kDa. Researchers should empirically determine the suitability of the GADD45A gadd45a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GADD45A/GADD45, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.