Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-GABRG2 Polyclonal Antibody – Cat# AAA198125 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: GABRG2Sample Type: Esophagus Tumor lysatesAntibody Dilution: 1.0ug/ml)

Gamma-Aminobutyric Acid Receptor Subunit Gamma-2 Isoform 1 (GABRG2) Antibody – Rabbit Polyclonal

GABRG2 Antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
GABRG2; CAE2; ECA2; GEFSP3
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GABRG2, Antibody; GABRG2 Antibody - N-terminal region; anti-GABRG2 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VPEGDVTVILNNLLEGYDNKLRPDIGVKPTLIHTDMYVNSIGPVNAINME
Sequence Length
475
Applicable Applications for anti-GABRG2 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human GABRG2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Host: RabbitTarget Name: GABRG2Sample Type: Esophagus Tumor lysatesAntibody Dilution: 1.0ug/ml)

Rabbit Anti-GABRG2 Polyclonal Antibody – Cat# AAA198125 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: GABRG2Sample Type: Esophagus Tumor lysatesAntibody Dilution: 1.0ug/ml)

IHC (Immunohistochemistry)

(Rabbit Anti-GABRG2 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult Brain, cerebellumObserved Staining: Cytoplasm in hepatocytesPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Rabbit Anti-GABRG2 Polyclonal Antibody – Cat# AAA198125 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Rabbit Anti-GABRG2 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult Brain, cerebellumObserved Staining: Cytoplasm in hepatocytesPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-GABRG2 antibody
This is a rabbit polyclonal antibody against GABRG2. It was validated on Western Blot

Target Description: This gene encodes a gamma-aminobutyric acid (GABA) receptor. GABA is the major inhibitory neurotransmitter in the mammlian brain, where it acts at GABA-A receptors, which are ligand-gated chloride channels. GABA-A receptors are pentameric, consisting of proteins from several subunit classes: alpha, beta, gamma, delta and rho. Mutations in this gene have been associated with epilepsy and febrile seizures.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52kDa
NCBI Official Full Name
gamma-aminobutyric acid receptor subunit gamma-2 isoform 1
NCBI Official Synonym Full Names
gamma-aminobutyric acid type A receptor gamma2 subunit
NCBI Official Symbol
GABRG2
NCBI Official Synonym Symbols
CAE2; ECA2; GEFSP3
NCBI Protein Information
gamma-aminobutyric acid receptor subunit gamma-2
UniProt Protein Name
Gamma-aminobutyric acid receptor subunit gamma-2
UniProt Gene Name
GABRG2
UniProt Entry Name
GBRG2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The GABRG2 gabrg2 (Catalog #AAA198125) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GABRG2 Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GABRG2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the GABRG2 gabrg2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VPEGDVTVIL NNLLEGYDNK LRPDIGVKPT LIHTDMYVNS IGPVNAINME. It is sometimes possible for the material contained within the vial of "GABRG2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.