Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-GABARAP Polyclonal Antibody – Cat# AAA200142 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-GABARAP Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 721_B cell lysate)

Gamma-Aminobutyric Acid Receptor-Associated Protein (GABARAP) Antibody – Rabbit Polyclonal

GABARAP antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
GABARAP; MM46; ATG8A; GABARAP-a
Reactivity
Cow, Dog, Human, Mouse, Pig, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GABARAP, Antibody; GABARAP antibody - N-terminal region; anti-GABARAP antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Dog, Human, Mouse, Pig, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLV
Sequence Length
117
Applicable Applications for anti-GABARAP antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Yeast: 79%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human GABARAP
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-GABARAP Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 721_B cell lysate)

Rabbit Anti-GABARAP Polyclonal Antibody – Cat# AAA200142 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-GABARAP Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 721_B cell lysate)

WB (Western Blot)

(Host: MouseTarget Name: GABARAPSample Tissue: Mouse Skeletal MuscleAntibody Dilution: 1ug/ml)

Rabbit Anti-GABARAP Polyclonal Antibody – Cat# AAA200142 – WB (Western Blot) WB (Western Blot) (Host: MouseTarget Name: GABARAPSample Tissue: Mouse Skeletal MuscleAntibody Dilution: 1ug/ml)
Related Product Information for anti-GABARAP antibody
This is a rabbit polyclonal antibody against GABARAP. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Gamma-aminobutyric acid A receptors [GABA(A) receptors] are ligand-gated chloride channels that mediate inhibitory neurotransmission. GABA(A) receptor-associated protein (GABARAP) is highly positively charged in its N-terminus and shares sequence similarity with light chain-3 of microtubule-associated proteins 1A and 1B. This protein clusters neurotransmitter receptors by mediating interaction with the cytoskeleton. Gamma-aminobutyric acid A receptors [GABA(A) receptors] are ligand-gated chloride channels that mediate inhibitory neurotransmission. This gene encodes GABA(A) receptor-associated protein, which is highly positively charged in its N-terminus and shares sequence similarity with light chain-3 of microtubule-associated proteins 1A and 1B. This protein clusters neurotransmitter receptors by mediating interaction with the cytoskeleton. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-GABARAP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
14kDa
NCBI Official Full Name
gamma-aminobutyric acid receptor-associated protein
NCBI Official Synonym Full Names
GABA type A receptor-associated protein
NCBI Official Symbol
GABARAP
NCBI Official Synonym Symbols
MM46; ATG8A; GABARAP-a
NCBI Protein Information
gamma-aminobutyric acid receptor-associated protein
UniProt Protein Name
Gamma-aminobutyric acid receptor-associated protein
UniProt Gene Name
GABARAP
UniProt Synonym Gene Names
FLC3B
UniProt Entry Name
GBRAP_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The GABARAP gabarap (Catalog #AAA200142) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GABARAP antibody - N-terminal region reacts with Cow, Dog, Human, Mouse, Pig, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's GABARAP can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the GABARAP gabarap for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KFVYKEEHPF EKRRSEGEKI RKKYPDRVPV IVEKAPKARI GDLDKKKYLV. It is sometimes possible for the material contained within the vial of "GABARAP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.