Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA28431_IP6.jpg IP (Immunoprecipitation) (Immunoprecipitation analysis of 300ug extracts of Jurkat cells using 3ug FUS antibody. Western blot was performed from the immunoprecipitate using FUS at a dilution of 1:1000.)

Rabbit FUS Polyclonal Antibody | anti-FUS antibody

FUS Rabbit pAb

Gene Names
MAFK; P18; NFE2U
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry, Immunoprecipitation
Purity
Affinity purification
Synonyms
FUS, Antibody; FUS Rabbit pAb; FUS; ALS6; ETM4; FUS1; HNRNPP2; POMP75; TLS; RNA-binding protein FUS; anti-FUS antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
MTTNPKPNKALKVKKEAGENAPVLSDDELVSMSVRELNQHLRGLTKEEVT
Applicable Applications for anti-FUS antibody
Western Blot (WB), Immunohistochemistry (IHC), Immunoprecipitation (IP)
Application Notes
WB: 1:500-1:2000
IHC: 1:50-1:200
IP: 1:50-1:200
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 297-526 of human FUS (NP_004951.1).
Cellular Location
Nucleus
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IP (Immunoprecipitation)

(Immunoprecipitation analysis of 300ug extracts of Jurkat cells using 3ug FUS antibody. Western blot was performed from the immunoprecipitate using FUS at a dilution of 1:1000.)

product-image-AAA28431_IP6.jpg IP (Immunoprecipitation) (Immunoprecipitation analysis of 300ug extracts of Jurkat cells using 3ug FUS antibody. Western blot was performed from the immunoprecipitate using FUS at a dilution of 1:1000.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded mouse spleen using FUS antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

product-image-AAA28431_IHC5.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded mouse spleen using FUS antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded mouse brain using FUS antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

product-image-AAA28431_IHC4.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded mouse brain using FUS antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded human breast cancer using FUS antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

product-image-AAA28431_IHC3.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded human breast cancer using FUS antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded rat brain using FUS antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

product-image-AAA28431_IHC2.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded rat brain using FUS antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using FUS antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 1s.)

product-image-AAA28431_WB.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using FUS antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 1s.)
Related Product Information for anti-FUS antibody
This gene encodes a multifunctional protein component of the heterogeneous nuclear ribonucleoprotein (hnRNP) complex. The hnRNP complex is involved in pre-mRNA splicing and the export of fully processed mRNA to the cytoplasm. This protein belongs to the FET family of RNA-binding proteins which have been implicated in cellular processes that include regulation of gene expression, maintenance of genomic integrity and mRNA/microRNA processing. Alternative splicing results in multiple transcript variants. Defects in this gene result in amyotrophic lateral sclerosis type 6.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17,523 Da
NCBI Official Full Name
transcription factor MafK
NCBI Official Synonym Full Names
v-maf avian musculoaponeurotic fibrosarcoma oncogene homolog K
NCBI Official Symbol
MAFK
NCBI Official Synonym Symbols
P18; NFE2U
NCBI Protein Information
transcription factor MafK; basic-leucine zipper transcription factor MafK; erythroid transcription factor NF-E2 p18 subunit; nuclear factor erythroid-2, ubiquitous (p18); v-maf avian musculoaponeurotic fibrosarcoma oncogene family, protein K; v-maf muscul
UniProt Protein Name
Transcription factor MafK
UniProt Gene Name
MAFK
UniProt Entry Name
MAFK_HUMAN

Similar Products

Product Notes

The FUS mafk (Catalog #AAA28431) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FUS Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's FUS can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC), Immunoprecipitation (IP). WB: 1:500-1:2000 IHC: 1:50-1:200 IP: 1:50-1:200. Researchers should empirically determine the suitability of the FUS mafk for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MTTNPKPNKA LKVKKEAGEN APVLSDDELV SMSVRELNQH LRGLTKEEVT. It is sometimes possible for the material contained within the vial of "FUS, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.