Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-FTH1 Polyclonal Antibody – Cat# AAA200387 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-FTH1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)

Ferritin Heavy Chain (FTH1) Antibody – Rabbit Polyclonal

FTH1 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
FTH1; FHC; FTH; HFE5; PLIF; FTHL6; PIG15
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
FTH1, Antibody; FTH1 antibody - middle region; anti-FTH1 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NVNQSLLELHKLATDKNDPHLCDFIETHYLNEQVKAIKELGDHVTNLRKM
Sequence Length
183
Applicable Applications for anti-FTH1 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 93%; Dog: 100%; Goat: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human FTH1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-FTH1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)

Rabbit Anti-FTH1 Polyclonal Antibody – Cat# AAA200387 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-FTH1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)

WB (Western Blot)

(Host: RabbitTarget Name: FTH1Sample Type: JurkatLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1ug/mlPeptide Concentration: 5ug/mlLysate Quantity: 25ug/lane/laneGel Concentration: 0.12)

Rabbit Anti-FTH1 Polyclonal Antibody – Cat# AAA200387 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: FTH1Sample Type: JurkatLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1ug/mlPeptide Concentration: 5ug/mlLysate Quantity: 25ug/lane/laneGel Concentration: 0.12)

WB (Western Blot)

(Host: RabbitTarget Name: FTH1Sample Type: HelaAntibody Dilution: 1.0ug/mlFTH1 is supported by BioGPS gene expression data to be expressed in HeLa)

Rabbit Anti-FTH1 Polyclonal Antibody – Cat# AAA200387 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: FTH1Sample Type: HelaAntibody Dilution: 1.0ug/mlFTH1 is supported by BioGPS gene expression data to be expressed in HeLa)

WB (Western Blot)

(Host: RabbitTarget Name: FTH1Sample Tissue: Human Ovary TumorAntibody Dilution: 1ug/ml)

Rabbit Anti-FTH1 Polyclonal Antibody – Cat# AAA200387 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: FTH1Sample Tissue: Human Ovary TumorAntibody Dilution: 1ug/ml)

IHC (Immunohistochemistry)

(Kidney)

Rabbit Anti-FTH1 Polyclonal Antibody – Cat# AAA200387 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Kidney)
Related Product Information for anti-FTH1 antibody
This is a rabbit polyclonal antibody against FTH1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: FTH1 is the heavy subunit of ferritin, the major intracellular iron storage protein in prokaryotes and eukaryotes. It is composed of 24 subunits of the heavy and light ferritin chains. Variation in ferritin subunit composition may affect the rates of iron uptake and release in different tissues. A major function of ferritin is the storage of iron in a soluble and nontoxic state. Defects in ferritin proteins are associated with several neurodegenerative diseases. This gene encodes the heavy subunit of ferritin, the major intracellular iron storage protein in prokaryotes and eukaryotes. It is composed of 24 subunits of the heavy and light ferritin chains. Variation in ferritin subunit composition may affect the rates of iron uptake and release in different tissues. A major function of ferritin is the storage of iron in a soluble and nontoxic state. Defects in ferritin proteins are associated with several neurodegenerative diseases. This gene has multiple pseudogenes. Several alternatively spliced transcript variants have been observed, but their biological validity has not been determined. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21kDa
NCBI Official Full Name
ferritin heavy chain
NCBI Official Synonym Full Names
ferritin heavy chain 1
NCBI Official Symbol
FTH1
NCBI Official Synonym Symbols
FHC; FTH; HFE5; PLIF; FTHL6; PIG15
NCBI Protein Information
ferritin heavy chain
UniProt Protein Name
Ferritin heavy chain
UniProt Gene Name
FTH1
UniProt Synonym Gene Names
FTH; FTHL6; Ferritin H subunit
UniProt Entry Name
FRIH_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The FTH1 fth1 (Catalog #AAA200387) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FTH1 antibody - middle region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's FTH1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the FTH1 fth1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NVNQSLLELH KLATDKNDPH LCDFIETHYL NEQVKAIKEL GDHVTNLRKM. It is sometimes possible for the material contained within the vial of "FTH1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.