Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200386_WB10.jpg WB (Western Blot) (WB Suggested Anti-FRK Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Transfected 293T)

Rabbit FRK Polyclonal Antibody | anti-FRK antibody

FRK antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
FRK; GTK; RAK; PTK5
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
FRK, Antibody; FRK antibody - N-terminal region; anti-FRK antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LCSPQSQRHGHYFVALFDYQARTAEDLSFRAGDKLQVLDTLHEGWWFARH
Sequence Length
505
Applicable Applications for anti-FRK antibody
WB (Western Blot)
Homology
Cow: 93%; Dog: 92%; Guinea Pig: 93%; Horse: 85%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human FRK
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-FRK Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Transfected 293T)

product-image-AAA200386_WB10.jpg WB (Western Blot) (WB Suggested Anti-FRK Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Transfected 293T)

WB (Western Blot)

(Host: RabbitTarget Name: FRKSample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

product-image-AAA200386_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: FRKSample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: FRKSample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

product-image-AAA200386_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: FRKSample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: FRKSample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

product-image-AAA200386_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: FRKSample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-FRK antibody
This is a rabbit polyclonal antibody against FRK. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The specific function of FRK is not yet known.The protein encoded by this gene belongs to the TYR family of protein kinases. This tyrosine kinase is a nuclear protein and may function during G1 and S phase of the cell cycle and suppress growth.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58kDa
NCBI Official Full Name
tyrosine-protein kinase FRK
NCBI Official Synonym Full Names
fyn related Src family tyrosine kinase
NCBI Official Symbol
FRK
NCBI Official Synonym Symbols
GTK; RAK; PTK5
NCBI Protein Information
tyrosine-protein kinase FRK
UniProt Protein Name
Tyrosine-protein kinase FRK
UniProt Gene Name
FRK
UniProt Synonym Gene Names
PTK5; RAK
UniProt Entry Name
FRK_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The FRK frk (Catalog #AAA200386) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FRK antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's FRK can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the FRK frk for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LCSPQSQRHG HYFVALFDYQ ARTAEDLSFR AGDKLQVLDT LHEGWWFARH. It is sometimes possible for the material contained within the vial of "FRK, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.