Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-FOXM1 Polyclonal Antibody – Cat# AAA23606 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-FOXM1 Antibody Titration: 1 ug/mlPositive Control: Jurkat cell lysate)

Forkhead Box Protein M1 Isoform 2 (FOXM1) Antibody – Rabbit Polyclonal

FOXM1 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
FOXM1; MPP2; HFH11; HNF-3; INS-1; MPP-2; PIG29; FKHL16; FOXM1A; FOXM1B; FOXM1C; HFH-11; TRIDENT; MPHOSPH2
Reactivity
Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
FOXM1, Antibody; FOXM1 antibody - middle region; anti-FOXM1 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ANRSLTEGLVLDTMNDSLSKILLDISFPGLDEDPLGPDNINWSQFIPELQ
Sequence Length
763
Applicable Applications for anti-FOXM1 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Dog: 83%; Guinea Pig: 83%; Human: 100%; Mouse: 91%; Rabbit: 91%; Rat: 91%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human FOXM1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-FOXM1 Antibody Titration: 1 ug/mlPositive Control: Jurkat cell lysate)

Rabbit Anti-FOXM1 Polyclonal Antibody – Cat# AAA23606 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-FOXM1 Antibody Titration: 1 ug/mlPositive Control: Jurkat cell lysate)

WB (Western Blot)

(Lanes:Lane 1: 25ug MIA PaCa-2 human pancreatic cancer cell line Lane 2: 25ug MDA-MB-231 cell lysateLane 3: 25ug Huh-7 cell lysatePrimary Antibody Dilution:1:2000Secondary Antibody:Anti-rabbit-HRPSecondary Antibody Dilution:1:5000Gene Name:FOXM1Submitted by:Andrei L. Gartel, University of Illinois at Chicago)

Rabbit Anti-FOXM1 Polyclonal Antibody – Cat# AAA23606 – WB (Western Blot) WB (Western Blot) (Lanes:Lane 1: 25ug MIA PaCa-2 human pancreatic cancer cell line Lane 2: 25ug MDA-MB-231 cell lysateLane 3: 25ug Huh-7 cell lysatePrimary Antibody Dilution:1:2000Secondary Antibody:Anti-rabbit-HRPSecondary Antibody Dilution:1:5000Gene Name:FOXM1Submitted by:Andrei L. Gartel, University of Illinois at Chicago)

WB (Western Blot)

(Host: RabbitTarget Name: FOXM1Sample Tissue: Human Jurkat Whole CellAntibody Dilution: 1ug/ml)

Rabbit Anti-FOXM1 Polyclonal Antibody – Cat# AAA23606 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: FOXM1Sample Tissue: Human Jurkat Whole CellAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: FOXM1Sample Tissue: Human 786-0 Whole CellAntibody Dilution: 1ug/ml)

Rabbit Anti-FOXM1 Polyclonal Antibody – Cat# AAA23606 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: FOXM1Sample Tissue: Human 786-0 Whole CellAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: FOXM1Sample Tissue: Human 293TAntibody Dilution: 1.0ug/ml)

Rabbit Anti-FOXM1 Polyclonal Antibody – Cat# AAA23606 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: FOXM1Sample Tissue: Human 293TAntibody Dilution: 1.0ug/ml)

IHC (Immunohistochemistry)

(Immunohistochemistry with Spleen cell lysate tissue at an antibody concentration of 5.0ug/ml using anti-FOXM1 antibody)

Rabbit Anti-FOXM1 Polyclonal Antibody – Cat# AAA23606 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Immunohistochemistry with Spleen cell lysate tissue at an antibody concentration of 5.0ug/ml using anti-FOXM1 antibody)

IHC (Immunohistochemistry)

(Immunohistochemistry with Human Spleen lysate tissue at an antibody concentration of 5.0ug/ml using anti-FOXM1 antibody)

Rabbit Anti-FOXM1 Polyclonal Antibody – Cat# AAA23606 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Immunohistochemistry with Human Spleen lysate tissue at an antibody concentration of 5.0ug/ml using anti-FOXM1 antibody)
Related Product Information for anti-FOXM1 antibody
This is a rabbit polyclonal antibody against FOXM1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: FOXM1 is a transcriptional activatory factor. It may play a role in the control of cell proliferation

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
84kDa
NCBI Official Full Name
forkhead box protein M1 isoform 2
NCBI Official Synonym Full Names
forkhead box M1
NCBI Official Symbol
FOXM1
NCBI Official Synonym Symbols
MPP2; HFH11; HNF-3; INS-1; MPP-2; PIG29; FKHL16; FOXM1A; FOXM1B; FOXM1C; HFH-11; TRIDENT; MPHOSPH2
NCBI Protein Information
forkhead box protein M1
UniProt Protein Name
Forkhead box protein M1
UniProt Gene Name
FOXM1
UniProt Synonym Gene Names
FKHL16; HFH11; MPP2; WIN; HFH-11; HNF-3/fork-head homolog 11
UniProt Entry Name
FOXM1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The FOXM1 foxm1 (Catalog #AAA23606) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FOXM1 antibody - middle region reacts with Dog, Guinea Pig, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's FOXM1 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the FOXM1 foxm1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ANRSLTEGLV LDTMNDSLSK ILLDISFPGL DEDPLGPDNI NWSQFIPELQ. It is sometimes possible for the material contained within the vial of "FOXM1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.