Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA23557_WB7.jpg WB (Western Blot) ( Host: RabbitTarget Name: FMODSample Tissue: Human MCF7 Whole CellAntibody Dilution: 3ug/ml)

Rabbit FMOD Polyclonal Antibody | anti-FMOD antibody

FMOD antibody - N-terminal region

Gene Names
FMOD; FM; SLRR2E
Reactivity
Tested Species Reactivity: Human, Horse
Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
FMOD, Antibody; FMOD antibody - N-terminal region; FM, SLRR2E; anti-FMOD antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Tested Species Reactivity: Human, Horse
Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer and 0.09% sodium azide
Concentration
0.5 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: VYFQNNQITSIQEGVFDNATGLLWIALHGNQITSDKVGRKVFSKLRHLER
Sequence Length
376
Applicable Applications for anti-FMOD antibody
QC Western Blot (WB)
Application Notes
QC Western Blot (WB): Pass
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human FMOD
Protein Size (# AA)
376 amino acids
Protein Interactions
BTBD1; ZBTB32; CUL3; Dlg4; TGFB3; TGFB2; TGFB1;
Blocking Peptide
For anti-FMOD (AAA23557) antibody is Catalog # ( )
Preparation and Storage
For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

( Host: RabbitTarget Name: FMODSample Tissue: Human MCF7 Whole CellAntibody Dilution: 3ug/ml)

product-image-AAA23557_WB7.jpg WB (Western Blot) ( Host: RabbitTarget Name: FMODSample Tissue: Human MCF7 Whole CellAntibody Dilution: 3ug/ml)

WB (Western Blot)

(Host: RabbitTarget: FMODPositive control (+): 293T (2T)Negative control (-): Human kidney (KI)Antibody concentration: 1ug/ml)

product-image-AAA23557_WB6.jpg WB (Western Blot) (Host: RabbitTarget: FMODPositive control (+): 293T (2T)Negative control (-): Human kidney (KI)Antibody concentration: 1ug/ml)

WB (Western Blot)

(WB Suggested Anti-FMOD Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysate)

product-image-AAA23557_WB5.jpg WB (Western Blot) (WB Suggested Anti-FMOD Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysate)

WB (Western Blot)

(Sample Type: Equine Cartilage ExplantsPrimary Dilution: 1:500Secondary: Bio-Rad 170-5046 (Dilution: 1:100,000))

product-image-AAA23557_WB4.jpg WB (Western Blot) (Sample Type: Equine Cartilage ExplantsPrimary Dilution: 1:500Secondary: Bio-Rad 170-5046 (Dilution: 1:100,000))

WB (Western Blot)

(Host: RabbitTarget Name: FMODSample Tissue: Human U937 Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA23557_WB3.jpg WB (Western Blot) (Host: RabbitTarget Name: FMODSample Tissue: Human U937 Whole CellAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: FMODSample Tissue: Human RPMI 8226 Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA23557_WB2.jpg WB (Western Blot) (Host: RabbitTarget Name: FMODSample Tissue: Human RPMI 8226 Whole CellAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: FMODSample Tissue: Human HelaAntibody Dilution: 1.0ug/ml)

product-image-AAA23557_WB.jpg WB (Western Blot) (Host: RabbitTarget Name: FMODSample Tissue: Human HelaAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-FMOD antibody
This is a rabbit polyclonal antibody against FMOD. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Fibromodulin is a member of a family of small interstitial proteoglycans, containing a central region composed of leucine-rich repeats with 4 keratan sulfate chains flanked by disulfide-bonded terminal domains. It may participate in the assembly of the extracellular matrix as it interacts with type I and type II collagen fibrils and inhibits fibrillogenesis in vitro. It may also regulate TGF-beta activities by sequestering TGF-beta into the extracellular matrix.Fibromodulin is a member of a family of small interstitial proteoglycans, containing a central region composed of leucine-rich repeats with 4 keratan sulfate chains flanked by disulfide-bonded terminal domains. It may participate in the assembly of the extracellular matrix as it interacts with type I and type II collagen fibrils and inhibits fibrillogenesis in vitro. It may also regulate TGF-beta activities by sequestering TGF-beta into the extracellular matrix. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-FMOD antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43kDa
NCBI Official Full Name
fibromodulin
NCBI Official Synonym Full Names
fibromodulin
NCBI Official Symbol
FMOD
NCBI Official Synonym Symbols
FM; SLRR2E
NCBI Protein Information
fibromodulin
UniProt Protein Name
Fibromodulin
UniProt Gene Name
FMOD
UniProt Synonym Gene Names
FM; SLRR2E; FM
UniProt Entry Name
FMOD_HUMAN

Similar Products

Product Notes

The FMOD fmod (Catalog #AAA23557) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FMOD antibody - N-terminal region reacts with Tested Species Reactivity: Human, Horse Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's FMOD can be used in a range of immunoassay formats including, but not limited to, QC Western Blot (WB). QC Western Blot (WB): Pass. Researchers should empirically determine the suitability of the FMOD fmod for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VYFQNNQITS IQEGVFDNAT GLLWIALHGN QITSDKVGRK VFSKLRHLER. It is sometimes possible for the material contained within the vial of "FMOD, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.