Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-FKBP1A Polyclonal Antibody – Cat# AAA201323 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-FKBP1A AntibodyTitration: 1.0 ug/mlPositive Control: 721_B Whole CellFKBP1A is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

Peptidyl-Prolyl Cis-Trans Isomerase FKBP1A Isoform A (FKBP1A) Antibody – Rabbit Polyclonal

FKBP1A antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
FKBP1A; FKBP1; PKC12; PKCI2; FKBP12; PPIASE; FKBP-12; FKBP-1A
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
FKBP1A, Antibody; FKBP1A antibody - N-terminal region; anti-FKBP1A antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSV
Sequence Length
108
Applicable Applications for anti-FKBP1A antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 93%; Zebrafish: 86%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-FKBP1A AntibodyTitration: 1.0 ug/mlPositive Control: 721_B Whole CellFKBP1A is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

Rabbit Anti-FKBP1A Polyclonal Antibody – Cat# AAA201323 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-FKBP1A AntibodyTitration: 1.0 ug/mlPositive Control: 721_B Whole CellFKBP1A is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

WB (Western Blot)

(Host: MouseTarget Name: FKBP1ASample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)

Rabbit Anti-FKBP1A Polyclonal Antibody – Cat# AAA201323 – WB (Western Blot) WB (Western Blot) (Host: MouseTarget Name: FKBP1ASample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)
Related Product Information for anti-FKBP1A antibody
This is a rabbit polyclonal antibody against FKBP1A. It was validated on Western Blot

Target Description: The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. The protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It interacts with several intracellular signal transduction proteins including type I TGF-beta receptor. It also interacts with multiple intracellular calcium release channels, and coordinates multi-protein complex formation of the tetrameric skeletal muscle ryanodine receptor. In mouse, deletion of this homologous gene causes congenital heart disorder known as noncompaction of left ventricular myocardium.
Product Categories/Family for anti-FKBP1A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
12kDa
NCBI Official Full Name
peptidyl-prolyl cis-trans isomerase FKBP1A isoform a
NCBI Official Synonym Full Names
FKBP prolyl isomerase 1A
NCBI Official Symbol
FKBP1A
NCBI Official Synonym Symbols
FKBP1; PKC12; PKCI2; FKBP12; PPIASE; FKBP-12; FKBP-1A
NCBI Protein Information
peptidyl-prolyl cis-trans isomerase FKBP1A
UniProt Protein Name
Peptidyl-prolyl cis-trans isomerase FKBP1A
UniProt Gene Name
FKBP1A
UniProt Synonym Gene Names
FKBP1; FKBP12; PPIase FKBP1A; 12 kDa FKBP; FKBP-12; FKBP-1A
UniProt Entry Name
FKB1A_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The FKBP1A fkbp1a (Catalog #AAA201323) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FKBP1A antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's FKBP1A can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the FKBP1A fkbp1a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GQTCVVHYTG MLEDGKKFDS SRDRNKPFKF MLGKQEVIRG WEEGVAQMSV. It is sometimes possible for the material contained within the vial of "FKBP1A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.