Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198987_WB13.jpg WB (Western Blot) (WB Suggested Anti-FGA Antibody Titration: 5.0ug/mlPositive Control: Jurkat cell lysate)

Rabbit FGA Polyclonal Antibody | anti-FGA antibody

FGA antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
FGA; Fib2
Reactivity
Cow, Dog, Goat, Horse, Human, Mouse, Pig, Rat, Sheep
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
FGA, Antibody; FGA antibody - N-terminal region; anti-FGA antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Goat, Horse, Human, Mouse, Pig, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MFSMRIVCLVLSVVGTAWTADSGEGDFLAEGGGVRGPRVVERHQSACKDS
Sequence Length
644
Applicable Applications for anti-FGA antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 93%; Dog: 86%; Goat: 91%; Horse: 85%; Human: 100%; Mouse: 86%; Pig: 93%; Rat: 91%; Sheep: 91%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human FGA
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-FGA Antibody Titration: 5.0ug/mlPositive Control: Jurkat cell lysate)

product-image-AAA198987_WB13.jpg WB (Western Blot) (WB Suggested Anti-FGA Antibody Titration: 5.0ug/mlPositive Control: Jurkat cell lysate)

IHC (Immunohistochemistry)

(Rabbit Anti-FGA AntibodyParaffin Embedded Tissue: Human SkinCellular Data: Squamous epithelial cellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

product-image-AAA198987_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-FGA AntibodyParaffin Embedded Tissue: Human SkinCellular Data: Squamous epithelial cellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Related Product Information for anti-FGA antibody
This is a rabbit polyclonal antibody against FGA. It was validated on Western Blot and immunohistochemistry

Target Description: FGA is the alpha component of fibrinogen, a blood-borne glycoprotein comprised of three pairs of nonidentical polypeptide chains. Following vascular injury, fibrinogen is cleaved by thrombin to form fibrin which is the most abundant component of blood clots. In addition, various cleavage products of fibrinogen and fibrin regulate cell adhesion and spreading, display vasoconstrictor and chemotactic activities, and are mitogens for several cell types. Mutations in its gene lead to several disorders, including dysfibrinogenemia, hypofibrinogenemia, afibrinogenemia and renal amyloidosis.The protein encoded by this gene is the alpha component of fibrinogen, a blood-borne glycoprotein comprised of three pairs of nonidentical polypeptide chains. Following vascular injury, fibrinogen is cleaved by thrombin to form fibrin which is the most abundant component of blood clots. In addition, various cleavage products of fibrinogen and fibrin regulate cell adhesion and spreading, display vasoconstrictor and chemotactic activities, and are mitogens for several cell types. Mutations in this gene lead to several disorders, including dysfibrinogenemia, hypofibrinogenemia, afibrinogenemia and renal amyloidosis. Alternative splicing results in two isoforms which vary in the carboxy-terminus.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
71kDa
NCBI Official Full Name
fibrinogen alpha chain isoform alpha
NCBI Official Synonym Full Names
fibrinogen alpha chain
NCBI Official Symbol
FGA
NCBI Official Synonym Symbols
Fib2
NCBI Protein Information
fibrinogen alpha chain

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The FGA (Catalog #AAA198987) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FGA antibody - N-terminal region reacts with Cow, Dog, Goat, Horse, Human, Mouse, Pig, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's FGA can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the FGA for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MFSMRIVCLV LSVVGTAWTA DSGEGDFLAE GGGVRGPRVV ERHQSACKDS. It is sometimes possible for the material contained within the vial of "FGA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.