Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-FECH Polyclonal Antibody – Cat# AAA198963 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-FECH Antibody Titration: 2.5ug/mlPositive Control: Jurkat cell lysateFECH is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

Ferrochelatase, Mitochondrial Isoform A (FECH) Antibody – Rabbit Polyclonal

FECH antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
FECH; EPP; FCE; EPP1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Protein A purified
Synonyms
FECH, Antibody; FECH antibody - N-terminal region; anti-FECH antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LDRDLMTLPIQNKLAPFIAKRRTPKIQEQYRRIGGGSPIKIWTSKQGEGM
Sequence Length
429
Applicable Applications for anti-FECH antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 77%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human FECH
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-FECH Antibody Titration: 2.5ug/mlPositive Control: Jurkat cell lysateFECH is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

Rabbit Anti-FECH Polyclonal Antibody – Cat# AAA198963 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-FECH Antibody Titration: 2.5ug/mlPositive Control: Jurkat cell lysateFECH is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

WB (Western Blot)

(Lanes:1. 6 ug mouse brain mitochondria extract 2. 6 ug mouse brain mitochondria extract 3. 6 ug mouse brain mitochondria extractPrimary Antibody Dilution:1:500Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:3000Gene Name:FECHSubmitted by:Dr. Hao Zhu, University of Kansas Medical Center)

Rabbit Anti-FECH Polyclonal Antibody – Cat# AAA198963 – WB (Western Blot) WB (Western Blot) (Lanes:1. 6 ug mouse brain mitochondria extract 2. 6 ug mouse brain mitochondria extract 3. 6 ug mouse brain mitochondria extractPrimary Antibody Dilution:1:500Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:3000Gene Name:FECHSubmitted by:Dr. Hao Zhu, University of Kansas Medical Center)
Related Product Information for anti-FECH antibody
This is a rabbit polyclonal antibody against FECH. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Ferrochelatase is localized to the mitochondrion where it catalyzes the insertion of the ferrous form of iron into protoporphyrin IX in the heme synthesis pathway. Defects in ferrochelatase are associated with protoporphyria.Ferrochelatase is localized to the mitochondrion where it catalyzes the insertion of the ferrous form of iron into protoporphyrin IX in the heme synthesis pathway. Defects in ferrochelatase are associated with protoporphyria. Two transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47kDa
NCBI Official Full Name
ferrochelatase, mitochondrial isoform a
NCBI Official Synonym Full Names
ferrochelatase
NCBI Official Symbol
FECH
NCBI Official Synonym Symbols
EPP; FCE; EPP1
NCBI Protein Information
ferrochelatase, mitochondrial
UniProt Protein Name
Ferrochelatase, mitochondrial
UniProt Gene Name
FECH
UniProt Entry Name
HEMH_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The FECH fech (Catalog #AAA198963) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FECH antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's FECH can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the FECH fech for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LDRDLMTLPI QNKLAPFIAK RRTPKIQEQY RRIGGGSPIK IWTSKQGEGM. It is sometimes possible for the material contained within the vial of "FECH, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.