Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-FADS1 Polyclonal Antibody – Cat# AAA199110 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-FADS1 Antibody Titration: 2.5ug/mlPositive Control: K562 cell lysateFADS1 is strongly supported by BioGPS gene expression data to be expressed in Human K562 cells)

Acyl-Coa (8-3)-Desaturase (FADS1) Antibody – Rabbit Polyclonal

FADS1 antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
FADS1; D5D; TU12; FADS6; FADSD5; LLCDL1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
FADS1, Antibody; FADS1 antibody - C-terminal region; anti-FADS1 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FNDWFSGHLNFQIEHHLFPTMPRHNYHKVAPLVQSLCAKHGIEYQSKPLL
Sequence Length
444
Applicable Applications for anti-FADS1 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human FADS1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-FADS1 Antibody Titration: 2.5ug/mlPositive Control: K562 cell lysateFADS1 is strongly supported by BioGPS gene expression data to be expressed in Human K562 cells)

Rabbit Anti-FADS1 Polyclonal Antibody – Cat# AAA199110 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-FADS1 Antibody Titration: 2.5ug/mlPositive Control: K562 cell lysateFADS1 is strongly supported by BioGPS gene expression data to be expressed in Human K562 cells)

WB (Western Blot)

(Host: RabbitTarget Name: FADS1Sample Tissue: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

Rabbit Anti-FADS1 Polyclonal Antibody – Cat# AAA199110 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: FADS1Sample Tissue: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

IHC (Immunohistochemistry)

(Human Muscle)

Rabbit Anti-FADS1 Polyclonal Antibody – Cat# AAA199110 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Human Muscle)
Related Product Information for anti-FADS1 antibody
This is a rabbit polyclonal antibody against FADS1. It was validated on Western Blot and immunohistochemistry

Target Description: FADS1 is a member of the fatty acid desaturase (FADS) family. Desaturase enzymes regulate unsaturation of fatty acids through the introduction of double bonds between defined carbons of the fatty acyl chain. FADS family members are considered fusion products composed of an N-terminal cytochrome b5-like domain and a C-terminal multiple membrane-spanning desaturase portion, both of which are characterized by conserved histidine motifs.The protein encoded by this gene is a member of the fatty acid desaturase (FADS) gene family. Desaturase enzymes regulate unsaturation of fatty acids through the introduction of double bonds between defined carbons of the fatty acyl chain. FADS family members are considered fusion products composed of an N-terminal cytochrome b5-like domain and a C-terminal multiple membrane-spanning desaturase portion, both of which are characterized by conserved histidine motifs. This gene is clustered with family members FADS1 and FADS2 at 11q12-q13.1; this cluster is thought to have arisen evolutionarily from gene duplication based on its similar exon/intron organization.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49kDa
NCBI Official Full Name
acyl-CoA (8-3)-desaturase
NCBI Official Synonym Full Names
fatty acid desaturase 1
NCBI Official Symbol
FADS1
NCBI Official Synonym Symbols
D5D; TU12; FADS6; FADSD5; LLCDL1
NCBI Protein Information
acyl-CoA (8-3)-desaturase; fatty acid desaturase 1
UniProt Protein Name
Fatty acid desaturase 1
UniProt Gene Name
FADS1
UniProt Synonym Gene Names
FADSD5; D5D; Delta(5) desaturase; Delta-5 desaturase
UniProt Entry Name
FADS1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The FADS1 fads1 (Catalog #AAA199110) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FADS1 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's FADS1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the FADS1 fads1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FNDWFSGHLN FQIEHHLFPT MPRHNYHKVA PLVQSLCAKH GIEYQSKPLL. It is sometimes possible for the material contained within the vial of "FADS1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.