Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-ETV1 Polyclonal Antibody – Cat# AAA198335 – IHC (Immunohistochemisry) IHC (Immunohistochemisry) (Immunohistochemistry with Brain, cortex tissue at an antibody concentration of 5ug/ml using anti-ETV1 antibody)

ETS Translocation Variant 1 Isoform A (ETV1) Antibody – Rabbit Polyclonal

ETV1 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
ETV1; ER81
Reactivity
Tested Species Reactivity: Human
Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
ETV1, Antibody; ETV1 antibody - middle region; RFWD2; CCND3; NSMCE2; SUMO1; UBC; RPS6KA5; KAT2B; EP300; MAPKAPK2; RPS6KA1; PRKACA; KCNA2; ERG; MAPK8; MAPK3; MAPK14; SPI1; NCOA3;; anti-ETV1 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Tested Species Reactivity: Human
Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: PDNQRPLLKTDMERHINEEDTVPLSHFDESMAYMPEGGCCNPHPYNEGYV
Sequence Length
477 amino acids
Applicable Applications for anti-ETV1 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ETV1
Protein Size (# AA)
477 amino acids
Protein Interactions
RFWD2; CCND3; NSMCE2; SUMO1; UBC; RPS6KA5; KAT2B; EP300; MAPKAPK2; RPS6KA1; PRKACA; KCNA2; ERG; MAPK8; MAPK3; MAPK14; SPI1; NCOA3;
Enhanced Validation
WB
Y
SPR
YCHAROS
Blocking Peptide
For anti-ETV1 (MBS3204129) antibody is Catalog #
Preparation and Storage
For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.

IHC (Immunohistochemisry)

(Immunohistochemistry with Brain, cortex tissue at an antibody concentration of 5ug/ml using anti-ETV1 antibody)

Rabbit Anti-ETV1 Polyclonal Antibody – Cat# AAA198335 – IHC (Immunohistochemisry) IHC (Immunohistochemisry) (Immunohistochemistry with Brain, cortex tissue at an antibody concentration of 5ug/ml using anti-ETV1 antibody)

WB (Western Blot)

(Human MDA-MB-435sHost: RabbitTarget Name: ETV1Sample Tissue: Human MDA-MB-435sAntibody Dilution: 1.0ug/ml)

Rabbit Anti-ETV1 Polyclonal Antibody – Cat# AAA198335 – WB (Western Blot) WB (Western Blot) (Human MDA-MB-435sHost: RabbitTarget Name: ETV1Sample Tissue: Human MDA-MB-435sAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(HEK293WB Suggested Anti-ETV1 AntibodyPositive Control:Lane 1: 100ug untransfected HEK293 lysateLane 2: 33ug ER81 transfected HEK293 lysatePrimary Antibody Dilution : 1:1000Secondary Antibody : Anti-rabbit-HRPSecondry Antibody Dilution : 1:2000Submitted by: Anonymous)

Rabbit Anti-ETV1 Polyclonal Antibody – Cat# AAA198335 – WB (Western Blot) WB (Western Blot) (HEK293WB Suggested Anti-ETV1 AntibodyPositive Control:Lane 1: 100ug untransfected HEK293 lysateLane 2: 33ug ER81 transfected HEK293 lysatePrimary Antibody Dilution : 1:1000Secondary Antibody : Anti-rabbit-HRPSecondry Antibody Dilution : 1:2000Submitted by: Anonymous)
Related Product Information for anti-ETV1 antibody
This is a rabbit polyclonal antibody against ETV1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: ETV1 is a transcriptional activator that binds to DNA sequences containing the consensus pentanucleotide 5'-CGGA[AT]-3'.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55kDa
NCBI Official Full Name
ETS translocation variant 1 isoform a
NCBI Official Synonym Full Names
ETS variant 1
NCBI Official Symbol
ETV1
NCBI Official Synonym Symbols
ER81
NCBI Protein Information
ETS translocation variant 1
UniProt Protein Name
ETS translocation variant 1
UniProt Gene Name
ETV1
UniProt Synonym Gene Names
ER81
UniProt Entry Name
ETV1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The ETV1 etv1 (Catalog #AAA198335) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ETV1 antibody - middle region reacts with Tested Species Reactivity: Human Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ETV1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the ETV1 etv1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PDNQRPLLKT DMERHINEED TVPLSHFDES MAYMPEGGCC NPHPYNEGYV. It is sometimes possible for the material contained within the vial of "ETV1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.