Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-ESRRG Polyclonal Antibody – Cat# AAA197206 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-ESRRG Antibody Titration: 0.5ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)

Estrogen-Related Receptor Gamma Isoform 2 (ESRRG) Antibody – Rabbit Polyclonal

ESRRG antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
ESRRG; ERR3; ERRg; NR3B3; ERRgamma; ERR-gamma
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
ESRRG, Antibody; ESRRG antibody - middle region; anti-ESRRG antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RIDAENSPYLNPQLVQPAKKPYNKIVSHLLVAEPEKIYAMPDPTVPDSDI
Sequence Length
458
Applicable Applications for anti-ESRRG antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ESRRG
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-ESRRG Antibody Titration: 0.5ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)

Rabbit Anti-ESRRG Polyclonal Antibody – Cat# AAA197206 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-ESRRG Antibody Titration: 0.5ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)

WB (Western Blot)

(Host: RabbitTarget Name: ESRRGSample Type: JurkatLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 2.5ug/mLPeptide Concentration: 2.0ug/mLLysate Quantity: 25ug/laneGel Concentration: 12%)

Rabbit Anti-ESRRG Polyclonal Antibody – Cat# AAA197206 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: ESRRGSample Type: JurkatLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 2.5ug/mLPeptide Concentration: 2.0ug/mLLysate Quantity: 25ug/laneGel Concentration: 12%)

WB (Western Blot)

(Host: MouseTarget Name: ESRRGSample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)

Rabbit Anti-ESRRG Polyclonal Antibody – Cat# AAA197206 – WB (Western Blot) WB (Western Blot) (Host: MouseTarget Name: ESRRGSample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)

IHC (Immunohistochemistry)

(Human Lung)

Rabbit Anti-ESRRG Polyclonal Antibody – Cat# AAA197206 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Human Lung)
Related Product Information for anti-ESRRG antibody
This is a rabbit polyclonal antibody against ESRRG. It was validated on Western Blot and immunohistochemistry

Target Description: ERRs, which are coexpressed with ERs in prostatic cells, could regulate cell growth and modulate ER-mediated pathways via interference on ERalpha transcription in prostatic cells. Not only PNRC2 but also the corepressor TLE1 functioned as ERRgamma coactivator in a reporter gene analysis. Transcriptional activation by ERR3 can be ligand-independent.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51kDa
NCBI Official Full Name
estrogen-related receptor gamma isoform 2
NCBI Official Synonym Full Names
estrogen related receptor gamma
NCBI Official Symbol
ESRRG
NCBI Official Synonym Symbols
ERR3; ERRg; NR3B3; ERRgamma; ERR-gamma
NCBI Protein Information
estrogen-related receptor gamma
UniProt Protein Name
Estrogen-related receptor gamma
UniProt Gene Name
ESRRG
UniProt Synonym Gene Names
ERR3; ERRG2; KIAA0832; NR3B3
UniProt Entry Name
ERR3_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The ESRRG esrrg (Catalog #AAA197206) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ESRRG antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ESRRG can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the ESRRG esrrg for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RIDAENSPYL NPQLVQPAKK PYNKIVSHLL VAEPEKIYAM PDPTVPDSDI. It is sometimes possible for the material contained within the vial of "ESRRG, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.