Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-ERF Polyclonal Antibody – Cat# AAA198392 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-ERF Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: OVCAR-3 cell lysate)

ETS Domain-Containing Transcription Factor ERF Isoform 1 (ERF) Antibody – Rabbit Polyclonal

ERF antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
ERF; PE2; CRS4; PE-2; CHYTS
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
ERF, Antibody; ERF antibody - N-terminal region; anti-ERF antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MKTPADTGFAFPDWAYKPESSPGSRQIQLWHFILELLRKEEYQGVIAWQG
Sequence Length
548
Applicable Applications for anti-ERF antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ERF
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-ERF Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: OVCAR-3 cell lysate)

Rabbit Anti-ERF Polyclonal Antibody – Cat# AAA198392 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-ERF Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: OVCAR-3 cell lysate)

IHC (Immunohistochemistry)

(Rabbit Anti-ERF AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: NucleusPrimary Antibody Concentration: 1:100Other Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Rabbit Anti-ERF Polyclonal Antibody – Cat# AAA198392 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Rabbit Anti-ERF AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: NucleusPrimary Antibody Concentration: 1:100Other Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-ERF antibody
This is a rabbit polyclonal antibody against ERF. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Members of the ETS family of transcription factors, such?as ERF, regulate cell proliferation and differentiation. They share?a highly conserved DNA-binding domain, the ETS domain, that?recognizes the sequence GGAA/T.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
59kDa
NCBI Official Full Name
ETS domain-containing transcription factor ERF isoform 1
NCBI Official Synonym Full Names
ETS2 repressor factor
NCBI Official Symbol
ERF
NCBI Official Synonym Symbols
PE2; CRS4; PE-2; CHYTS
NCBI Protein Information
ETS domain-containing transcription factor ERF
UniProt Protein Name
ETS domain-containing transcription factor ERF
UniProt Gene Name
ERF
UniProt Entry Name
ERF_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The ERF erf (Catalog #AAA198392) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ERF antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ERF can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the ERF erf for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MKTPADTGFA FPDWAYKPES SPGSRQIQLW HFILELLRKE EYQGVIAWQG. It is sometimes possible for the material contained within the vial of "ERF, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.