Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-ERCC8 Polyclonal Antibody – Cat# AAA23386 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-ERCC8 antibody Titration: 1 ug/mLSample Type: Human liver)

DNA Excision Repair Protein ERCC-8 Isoform 1 (ERCC8) Antibody – Rabbit Polyclonal

ERCC8 antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
ERCC8; CSA; CKN1; UVSS2
Reactivity
Dog, Horse, Human, Pig, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
ERCC8, Antibody; ERCC8 antibody - C-terminal region; anti-ERCC8 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Dog, Horse, Human, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QELYSGSRDCNILAWVPSLYEPVPDDDETTTKSQLNPAFEDAWSSSDEEG
Sequence Length
396
Applicable Applications for anti-ERCC8 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Dog: 93%; Horse: 86%; Human: 100%; Pig: 79%; Rabbit: 79%; Rat: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human ERCC8
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-ERCC8 antibody Titration: 1 ug/mLSample Type: Human liver)

Rabbit Anti-ERCC8 Polyclonal Antibody – Cat# AAA23386 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-ERCC8 antibody Titration: 1 ug/mLSample Type: Human liver)

WB (Western Blot)

(WB Suggested Anti-ERCC8 Antibody Titration: 0.1-5.0ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)

Rabbit Anti-ERCC8 Polyclonal Antibody – Cat# AAA23386 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-ERCC8 Antibody Titration: 0.1-5.0ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)

WB (Western Blot)

(Host: RabbitTarget Name: ERCC8Sample Type: MCF7 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit Anti-ERCC8 Polyclonal Antibody – Cat# AAA23386 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: ERCC8Sample Type: MCF7 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: ERCC8Sample Type: Human HepG2Antibody Dilution: 1.0ug/mlERCC8 is supported by BioGPS gene expression data to be expressed in HepG2)

Rabbit Anti-ERCC8 Polyclonal Antibody – Cat# AAA23386 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: ERCC8Sample Type: Human HepG2Antibody Dilution: 1.0ug/mlERCC8 is supported by BioGPS gene expression data to be expressed in HepG2)

WB (Western Blot)

(Host: RabbitTarget Name: ERCC8Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

Rabbit Anti-ERCC8 Polyclonal Antibody – Cat# AAA23386 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: ERCC8Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: ERCC8Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

Rabbit Anti-ERCC8 Polyclonal Antibody – Cat# AAA23386 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: ERCC8Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: ERCC8Sample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)

Rabbit Anti-ERCC8 Polyclonal Antibody – Cat# AAA23386 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: ERCC8Sample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: ERCC8Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

Rabbit Anti-ERCC8 Polyclonal Antibody – Cat# AAA23386 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: ERCC8Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

IHC (Immunohistochemistry)

(HumanMuscle)

Rabbit Anti-ERCC8 Polyclonal Antibody – Cat# AAA23386 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (HumanMuscle)

IHC (Immunohistochemistry)

(Human Liver)

Rabbit Anti-ERCC8 Polyclonal Antibody – Cat# AAA23386 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Human Liver)
Related Product Information for anti-ERCC8 antibody
This is a rabbit polyclonal antibody against ERCC8. It was validated on Western Blot and immunohistochemistry

Target Description: ERCC8 (excision repair cross-complementing rodent repair deficiency, complementation group 8 isoform 1) is a WD repeat protein, which interacts with Cockayne syndrome type B (CSB) protein and with p44 protein, a subunit of the RNA polymerase II transcript

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44kDa
NCBI Official Full Name
DNA excision repair protein ERCC-8 isoform 1
NCBI Official Synonym Full Names
ERCC excision repair 8, CSA ubiquitin ligase complex subunit
NCBI Official Symbol
ERCC8
NCBI Official Synonym Symbols
CSA; CKN1; UVSS2
NCBI Protein Information
DNA excision repair protein ERCC-8
UniProt Protein Name
DNA excision repair protein ERCC-8
UniProt Gene Name
ERCC8
UniProt Synonym Gene Names
CKN1; CSA
UniProt Entry Name
ERCC8_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The ERCC8 ercc8 (Catalog #AAA23386) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ERCC8 antibody - C-terminal region reacts with Dog, Horse, Human, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ERCC8 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the ERCC8 ercc8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QELYSGSRDC NILAWVPSLY EPVPDDDETT TKSQLNPAFE DAWSSSDEEG. It is sometimes possible for the material contained within the vial of "ERCC8, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.