Epithelial-Stromal Interaction Protein 1 Isoform 1 (EPSTI1) Antibody – Rabbit Polyclonal
EPSTI1 antibody - N-terminal region
Gene Names
EPSTI1; BRESI1
Reactivity
Tested Species Reactivity HumanPredicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
EPSTI1, Antibody; EPSTI1 antibody - N-terminal region; anti-EPSTI1 antibody
Product Overview
Host
Rabbit
Reactivity
Tested Species Reactivity Human
Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Rabbit
Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: RRLGGSQSETEVRQKQQLQLMQSKYKQKLKREESVRIKKEAEEAELQKMK
Sequence Length
410
Applicable Applications for anti-EPSTI1 antibody
WB (Western Blot)
Homology
Cow: 86%; Dog: 86%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 86%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human EPSTI1
Protein Interactions
CUL1
Protein Size (# AA)
410 amino acids
Blocking Peptide
For anti-EPSTI1 (MBS3209011) antibody is Catalog #
Preparation and Storage
For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-EPSTI1 antibody
This is a rabbit polyclonal antibody against EPSTI1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: EPSTI1 was up-regulated in breast carcinomas. The exact function of EPSTI1 is not known.
Target Description: EPSTI1 was up-regulated in breast carcinomas. The exact function of EPSTI1 is not known.
Product Categories/Family for anti-EPSTI1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47kDa
NCBI Official Full Name
epithelial-stromal interaction protein 1 isoform 1
NCBI Official Synonym Full Names
epithelial stromal interaction 1
NCBI Official Symbol
EPSTI1
NCBI Official Synonym Symbols
BRESI1
NCBI Protein Information
epithelial-stromal interaction protein 1
UniProt Protein Name
Epithelial-stromal interaction protein 1
UniProt Gene Name
EPSTI1
UniProt Entry Name
ESIP1_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Additional Details
Product Notes
The EPSTI1 epsti1 (Catalog #AAA199917) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EPSTI1 antibody - N-terminal region reacts with Tested Species Reactivity Human Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's EPSTI1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the EPSTI1 epsti1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RRLGGSQSET EVRQKQQLQL MQSKYKQKLK REESVRIKKE AEEAELQKMK. It is sometimes possible for the material contained within the vial of "EPSTI1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
