Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA28275_IF7.jpg IF (Immunofluorescence) (Immunofluorescence analysis of U-2 OS cells using DYNLL1 Rabbit pAb (AAA28275) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

Rabbit DYNLL1 Polyclonal Antibody | anti-DYNLL1 antibody

DYNLL1 Polyclonal Antibody

Gene Names
DYNLL1; LC8; PIN; DLC1; DLC8; LC8a; DNCL1; hdlc1; DNCLC1
Applications
Western Blot, Immunohistochemistry, Immunofluorescence
Purity
Affinity Purification
Synonyms
DYNLL1, Antibody; DYNLL1 Polyclonal Antibody; DLC1; DLC8; DNCL1; DNCLC1; hdlc1; LC8; LC8a; PIN; anti-DYNLL1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
Sequence Length
89
Applicable Applications for anti-DYNLL1 antibody
Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF)
Application Notes
WB: 1:500 - 1:2000
IHC: 1:50-1:100
IF: 1:50-1:100
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-89 of human DYNLL1 (NP_003737.1)
Species Reactivity/Cross-Reactivity
Human, Rat
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of U-2 OS cells using DYNLL1 Rabbit pAb (AAA28275) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

product-image-AAA28275_IF7.jpg IF (Immunofluorescence) (Immunofluorescence analysis of U-2 OS cells using DYNLL1 Rabbit pAb (AAA28275) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of NIH-3T3 cells using DYNLL1 Rabbit pAb (AAA28275) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

product-image-AAA28275_IF6.jpg IF (Immunofluorescence) (Immunofluorescence analysis of NIH-3T3 cells using DYNLL1 Rabbit pAb (AAA28275) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of C6 cells using DYNLL1 Rabbit pAb (AAA28275) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

product-image-AAA28275_IF5.jpg IF (Immunofluorescence) (Immunofluorescence analysis of C6 cells using DYNLL1 Rabbit pAb (AAA28275) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded mouse kidney using DYNLL1 Rabbit pAb (AAA28275) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

product-image-AAA28275_IHC4.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded mouse kidney using DYNLL1 Rabbit pAb (AAA28275) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded human colon carcinoma using DYNLL1 Rabbit pAb (AAA28275) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

product-image-AAA28275_IHC3.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded human colon carcinoma using DYNLL1 Rabbit pAb (AAA28275) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded rat ovary using DYNLL1 Rabbit pAb (AAA28275) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

product-image-AAA28275_IHC2.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded rat ovary using DYNLL1 Rabbit pAb (AAA28275) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using DYNLL1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.)

product-image-AAA28275_WB.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using DYNLL1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.)
Related Product Information for anti-DYNLL1 antibody
Cytoplasmic dyneins are large enzyme complexes with a molecular mass of about 1,200 kD. They contain two force-producing heads formed primarily from dynein heavy chains, and stalks linking the heads to a basal domain, which contains a varying number of accessory intermediate chains. The complex is involved in intracellular transport and motility. The protein described in this record is a light chain and exists as part of this complex but also physically interacts with and inhibits the activity of neuronal nitric oxide synthase. Binding of this protein destabilizes the neuronal nitric oxide synthase dimer, a conformation necessary for activity, and it may regulate numerous biologic processes through its effects on nitric oxide synthase activity. Alternate transcriptional splice variants have been characterized.
Product Categories/Family for anti-DYNLL1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Observed: 11kDa
NCBI Official Full Name
dynein light chain 1, cytoplasmic
NCBI Official Synonym Full Names
dynein light chain LC8-type 1
NCBI Official Symbol
DYNLL1
NCBI Official Synonym Symbols
LC8; PIN; DLC1; DLC8; LC8a; DNCL1; hdlc1; DNCLC1
NCBI Protein Information
dynein light chain 1, cytoplasmic
UniProt Protein Name
Dynein light chain 1, cytoplasmic
UniProt Gene Name
DYNLL1
UniProt Synonym Gene Names
DLC1; DNCL1; DNCLC1; HDLC1; DLC8; PIN

Similar Products

Product Notes

The DYNLL1 dynll1 (Catalog #AAA28275) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's DYNLL1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF). WB: 1:500 - 1:2000 IHC: 1:50-1:100 IF: 1:50-1:100. Researchers should empirically determine the suitability of the DYNLL1 dynll1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MCDRKAVIKN ADMSEEMQQD SVECATQALE KYNIEKDIAA HIKKEFDKKY NPTWHCIVGR NFGSYVTHET KHFIYFYLGQ VAILLFKSG. It is sometimes possible for the material contained within the vial of "DYNLL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.