Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-DTNB Polyclonal Antibody – Cat# AAA201540 – WB (Western Blot) WB (Western Blot) (Host: RatTarget Name: DTNBSample Tissue: Rat LiverAntibody Dilution: 1ug/ml)

Dystrobrevin Beta Isoform 6 (DTNB) Antibody – Rabbit Polyclonal

DTNB Antibody - C-terminal region

Average rating 0.0
No ratings yet
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
DTNB, Antibody; DTNB Antibody - C-terminal region; anti-DTNB antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EQKQAAQATGSPHTSPTHGGGRPMPMPVRSTSAGSTPTHCPQDSLSGVGG
Sequence Length
567
Applicable Applications for anti-DTNB antibody
WB (Western Blot)
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human DTNB
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Host: RatTarget Name: DTNBSample Tissue: Rat LiverAntibody Dilution: 1ug/ml)

Rabbit Anti-DTNB Polyclonal Antibody – Cat# AAA201540 – WB (Western Blot) WB (Western Blot) (Host: RatTarget Name: DTNBSample Tissue: Rat LiverAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: DTNBSample Type: Fetal Liver lysatesAntibody Dilution: 1.0ug/ml)

Rabbit Anti-DTNB Polyclonal Antibody – Cat# AAA201540 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: DTNBSample Type: Fetal Liver lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-DTNB antibody
This is a rabbit polyclonal antibody against DTNB. It was validated on Western Blot

Target Description: This gene encodes dystrobrevin beta, a component of the dystrophin-associated protein complex (DPC). The DPC consists of dystrophin and several integral and peripheral membrane proteins, including dystroglycans, sarcoglycans, syntrophins and dystrobrevin alpha and beta. The DPC localizes to the sarcolemma and its disruption is associated with various forms of muscular dystrophy. Dystrobrevin beta is thought to interact with syntrophin and the DP71 short form of dystrophin. Alternatively spliced transcript variants encoding different isoforms have been identified.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
62kDa
NCBI Official Full Name
dystrobrevin beta isoform 6
NCBI Official Synonym Full Names
dystrobrevin beta
NCBI Official Symbol
DTNB
NCBI Protein Information
dystrobrevin beta
UniProt Protein Name
Dystrobrevin beta
UniProt Gene Name
DTNB
UniProt Synonym Gene Names
DTN-B
UniProt Entry Name
DTNB_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The DTNB dtnb (Catalog #AAA201540) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DTNB Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DTNB can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the DTNB dtnb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EQKQAAQATG SPHTSPTHGG GRPMPMPVRS TSAGSTPTHC PQDSLSGVGG. It is sometimes possible for the material contained within the vial of "DTNB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.