Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-DPH1 Polyclonal Antibody – Cat# AAA200197 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-DPH1 Antibody Titration: 0.2-1 ug/mlPositive Control: MCF7 cell lysateDPH1 is supported by BioGPS gene expression data to be expressed in MCF7)

2(3-Amino-3-Carboxypropyl)Histidine Synthase Subunit 1 Isoform 1 (DPH1) Antibody – Rabbit Polyclonal

DPH1 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
DPH1; DPH2L; OVCA1; DEDSSH; DPH2L1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
DPH1, Antibody; DPH1 antibody - middle region; anti-DPH1 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RMQAARQEAIATARSAKSWGLILGTLGRQGSPKILEHLESRLRALGLSFV
Sequence Length
443
Applicable Applications for anti-DPH1 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 83%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human DPH1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-DPH1 Antibody Titration: 0.2-1 ug/mlPositive Control: MCF7 cell lysateDPH1 is supported by BioGPS gene expression data to be expressed in MCF7)

Rabbit Anti-DPH1 Polyclonal Antibody – Cat# AAA200197 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-DPH1 Antibody Titration: 0.2-1 ug/mlPositive Control: MCF7 cell lysateDPH1 is supported by BioGPS gene expression data to be expressed in MCF7)

IHC (Immunohistochemistry)

(Rabbit Anti-DPH1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult LiverObserved Staining: Cytoplasm (perinuclear) but not nuclear in hepatocytes, strong signal, low tissue distributionPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)

Rabbit Anti-DPH1 Polyclonal Antibody – Cat# AAA200197 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Rabbit Anti-DPH1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult LiverObserved Staining: Cytoplasm (perinuclear) but not nuclear in hepatocytes, strong signal, low tissue distributionPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)
Related Product Information for anti-DPH1 antibody
This is a rabbit polyclonal antibody against DPH1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Diphthamide is a unique posttranslationally modified histidine found only in translation elongation factor-2 (EEF2; MIM 130610). This modification is conserved from archaebacteria to humans and serves as the target for ADP-ribosylation and inactivation of EEF2 by diphtheria toxin (DT) and Pseudomonas exotoxin A. DPH1 is 1 of several enzymes involved in synthesis of diphthamide in EEF2 (Liu et al., 2004 [PubMed 15485916]). Diphthamide is a unique posttranslationally modified histidine found only in translation elongation factor-2 (EEF2; MIM 130610). This modification is conserved from archaebacteria to humans and serves as the target for ADP-ribosylation and inactivation of EEF2 by diphtheria toxin (DT) and Pseudomonas exotoxin A. DPH1 is 1 of several enzymes involved in synthesis of diphthamide in EEF2 (Liu et al., 2004 [PubMed 15485916]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-40 AF321876.1 1-40 41-1028 BC003099.1 3-990 1029-1410 BP417755.1 78-459 1411-2188 AK090530.1 1484-2261 2189-2200 AF321876.1 2189-2200
Product Categories/Family for anti-DPH1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49kDa
NCBI Official Full Name
2-(3-amino-3-carboxypropyl)histidine synthase subunit 1 isoform 1
NCBI Official Synonym Full Names
diphthamide biosynthesis 1
NCBI Official Symbol
DPH1
NCBI Official Synonym Symbols
DPH2L; OVCA1; DEDSSH; DPH2L1
NCBI Protein Information
2-(3-amino-3-carboxypropyl)histidine synthase subunit 1
UniProt Protein Name
Diphthamide biosynthesis protein 1
UniProt Gene Name
DPH1
UniProt Synonym Gene Names
DPH2L; DPH2L1; OVCA1
UniProt Entry Name
DPH1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The DPH1 dph1 (Catalog #AAA200197) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DPH1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's DPH1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the DPH1 dph1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RMQAARQEAI ATARSAKSWG LILGTLGRQG SPKILEHLES RLRALGLSFV. It is sometimes possible for the material contained within the vial of "DPH1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.