Deoxyribonuclease Gamma Isoform 1 (DNASE1L3) Antibody – Rabbit Polyclonal
DNASE1L3 antibody - C-terminal region
Gene Names
DNASE1L3; LSD; DHP2; SLEB16; DNAS1L3
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
DNASE1L3, Antibody; DNASE1L3 antibody - C-terminal region; anti-DNASE1L3 antibody
Product Overview
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DFQKAYKLTEEEALDVSDHFPVEFKLQSSRAFTNSKKSVTLRKKTKSKRS
Sequence Length
305
Applicable Applications for anti-DNASE1L3 antibody
WB (Western Blot)
Homology
Human: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-DNASE1L3 antibody
This is a rabbit polyclonal antibody against DNASE1L3. It was validated on Western Blot
Target Description: This gene encodes a member of the DNase family. The protein hydrolyzes DNA, is not inhibited by actin, and mediates the breakdown of DNA during apoptosis. Alternate transcriptional splice variants of this gene have been observed but have not been thoroughly characterized.
Target Description: This gene encodes a member of the DNase family. The protein hydrolyzes DNA, is not inhibited by actin, and mediates the breakdown of DNA during apoptosis. Alternate transcriptional splice variants of this gene have been observed but have not been thoroughly characterized.
Product Categories/Family for anti-DNASE1L3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34kDa
NCBI Official Full Name
deoxyribonuclease gamma isoform 1
NCBI Official Synonym Full Names
deoxyribonuclease 1 like 3
NCBI Official Symbol
DNASE1L3
NCBI Official Synonym Symbols
LSD; DHP2; SLEB16; DNAS1L3
NCBI Protein Information
deoxyribonuclease gamma
UniProt Protein Name
Deoxyribonuclease gamma
UniProt Gene Name
DNASE1L3
UniProt Synonym Gene Names
DHP2; DNAS1L3; DNase gamma; DNase I-like 3; LS-DNase; LSD
UniProt Entry Name
DNSL3_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Additional Details
Product Notes
The DNASE1L3 dnase1l3 (Catalog #AAA201110) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DNASE1L3 antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DNASE1L3 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the DNASE1L3 dnase1l3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DFQKAYKLTE EEALDVSDHF PVEFKLQSSR AFTNSKKSVT LRKKTKSKRS. It is sometimes possible for the material contained within the vial of "DNASE1L3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
