Dehydrogenase/Reductase SDR Family Member 7B Isoform 1 (DHRS7B) Antibody – Rabbit Polyclonal
DHRS7B antibody - middle region
Gene Names
DHRS7B; CGI-93; SDR32C1
Reactivity
Species Reactivity: Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
DHRS7B, Antibody; DHRS7B antibody - middle region; anti-DHRS7B antibody
Product Overview
Host
Rabbit
Reactivity
Species Reactivity: Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/mL (varies by lot)
Sequence
Synthetic peptide located within the following region: QAFFDCLRAEMEQYEIEVTVISPGYIHTNLSVNAITADGSRYGVMDTTTA
Sequence Length
325
Applicable Applications for anti-DHRS7B antibody
WB (Western Blot)
Predicted Species Reactivity
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit.
Predicted Homology Based on Immunogen Sequence
Cow: 86%, Dog: 86%, Guinea Pig: 93%; Human: 100%; Mouse 93%; Rabbit 93%; Rat 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human DHRS7B
Protein Size (#AA)
325 amino acids
Protein Interactions
HECW2; TP53BP1; ACIN1; APP; UBD; UBC; BRE; MED19
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-DHRS7B antibody
This is a rabbit polyclonal antibody against DHRS7B. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: This gene is located within the Smith-Magenis syndrome region on chromosome 17. It encodes a protein of unknown function.
Target Description: This gene is located within the Smith-Magenis syndrome region on chromosome 17. It encodes a protein of unknown function.
Product Categories/Family for anti-DHRS7B antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35kDa
NCBI Official Full Name
dehydrogenase/reductase SDR family member 7B isoform 1
NCBI Official Synonym Full Names
dehydrogenase/reductase 7B
NCBI Official Symbol
DHRS7B
NCBI Official Synonym Symbols
CGI-93; SDR32C1
NCBI Protein Information
dehydrogenase/reductase SDR family member 7B
UniProt Protein Name
Dehydrogenase/reductase SDR family member 7B
UniProt Gene Name
DHRS7B
UniProt Synonym Gene Names
CGI-93; UNQ212/PRO238
UniProt Entry Name
DRS7B_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Additional Details
Product Notes
The DHRS7B dhrs7b (Catalog #AAA199777) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DHRS7B antibody - middle region reacts with Species Reactivity: Human and may cross-react with other species as described in the data sheet. AAA Biotech's DHRS7B can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the DHRS7B dhrs7b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QAFFDCLRAE MEQYEIEVTV ISPGYIHTNL SVNAITADGS RYGVMDTTTA. It is sometimes possible for the material contained within the vial of "DHRS7B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
