Rabbit DDIT3 / CHOP Polyclonal Antibody | anti-DDIT3 / CHOP antibody

Anti-DDIT3 / CHOP Antibody IHC-plus

Cat. Num. AAA162218

• Gene Names: DDIT3; CHOP; CEBPZ; CHOP10; CHOP-10; GADD153
• Reactivity: Mouse, Rat, Human
• Applications: Western Blot, Immunofluorescence, Immunohistochemistry
• Purity: Affinity purified
• Synonyms: DDIT3 / CHOP, Antibody; Anti-DDIT3 / CHOP Antibody IHC-plus; DDIT3 Antibody, CHOP10 Antibody, DDIT-3 Antibody, CHOP Antibody, GADD153 Antibody, C/EBP zeta Antibody, C/EBP-homologous protein Antibody, C/EBP-homologous protein 10 Antibody, CHOP-10 Antibody; anti-DDIT3 / CHOP antibody

• Host: Rabbit
• Reactivity: Mouse, Rat, Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Human DDIT3 / CHOP
• Purity/Purification: Affinity purified
• Form/Format: PBS, pH 7.3, 0.02% sodium azide, 50% glycerol.
• Concentration: 4.62mg/ml (varies by lot)
• Sequence: GRTRKRKQSGHSPARAGKQRMKEKEQENERKVAQLAEENERLKQEIERLTREVEATRRALIDRMVNLHQA
• Sequence Length: 169

• Applicable Applications for anti-DDIT3 / CHOP antibody: WB (Western Blot), IF (Immunofluorescence), IHC (Immunohistochemistry)
• Immunogen: DDIT3/CHOP antibody was raised against a synthetic peptide corresponding to a sequence within amino acids 100 to the C-Terminus of human DDIT3 (NP_004074.2).
• Immunogen Species: DDIT3/CHOP antibody was raised against Human
• Antigen Type: Synthetic peptide
• Usage: The predicted MW is 19kDa/21kDa, while the observed MW by Western blot was 26kDa.
• Target Species: Human
• Disclaimer: Due to the highly specific nature of antibodies and antigens, we cannot predict or be held responsible with respect to how this antibody will behave in your systems. Researchers using this antibody should conduct optimization studies to achieve the most optimal result possible for their intended application.
• Recommended Immunohistochemistry Protocol: The following protocol is a recommendation only, and AAA Biotech makes no guarantee of the results:; ; Tissue Preparation: ; Formalin fixation and embedding in paraffin wax. ; ; Tissue Sectioning: ; Make 4-um sections and place on pre-cleaned and charged microscope slides. Heat in a tissue-dryingoven for 45 minutes at 60°C. ; ; Deparaffinization: ; Wash dry slides in 3 changes of xylene - 5 minutes each @ RT; ; Rehydration: ; Wash slides in 3 changes of 100% alcohol - 3 minutes each @ RT; Wash slides in 2 changes of 95% alcohol - 3 minutes each @ RT; Wash slides in 1 change of 80% alcohol - 3 minutes @ RT; Rinse slides in gentle running distilled water - 5 minutes @ RT; ; Antigen retrieval: ; Steam slides in 0.01 M sodium citrate buffer, pH 6.0 at 99-100°C - 20 minutes; Remove from heat and let stand at room temperature in buffer - 20 minutes; Rinse in 1X TBS with Tween (TBST) -1 minute @ RT; ; Immunostaining: ; (Do not allow tissues to dry at any time during the staining procedure) ; Apply a universal protein block - 20 minutes @ RT; Drain protein block from slides, apply diluted primary antibody - 45 minutes @ RT; Rinse slides in 1 X TBST - 1 minute @ RT; Apply a biotinylated secondary antibody appropriate for the primary antibody - 30 minutes @ RT; Rinse slides in 1X TBST -1 minute @ RT; Apply alkaline phosphatase streptavidin - 30 minutes @ RT; Rinse slides in 1X TBST -1 minute @ RT; Apply alkaline phosphatase chromogen substrate - 30 minutes @ RT; Wash slides in distilled water - 1 minute @ RT; ; Dehydrate: ; (This method should only be used if the chromogen substrate is alcohol insoluble (e.g. Vector Red, DAB) ; Wash slides in 2 changes of 80% alcohol - 1 minute each @ RT; Wash slides in 2 changes of 95% alcohol - 1 minute each @ RT; Wash slides in 3 changes of 100% alcohol - 1 minute each @ RT; Wash slides in 3 changes of xylene - 1 minute each @ RT; Apply coverslip
• Preparation and Storage: Store at -20 degree C; Avoid freeze-thaw cycles.

WB (Western Blot)

(Western blot analysis of extracts of various cell lines.)

WB (Western Blot)

(Western blot analysis of extracts from mouse craniofacial tissue, using DDIT3 antibody.)

IF (Immunofluorescence)

(Immunofluorescence analysis of A549 cell using DDIT3 antibody. Blue: DAPI for nuclear staining.)

IHC (Immunohistochemistry)

(Human Small Intestine: Formalin-Fixed, Paraffin-Embedded (FFPE))

Related Product Information for anti-DDIT3 / CHOP antibody

DDIT3 Antibody, CHOP10 Antibody, DDIT-3 Antibody, CHOP Antibody, GADD153 Antibody, C/EBP zeta Antibody, C/EBP-homologous protein Antibody, C/EBP-homologous protein 10 Antibody, CHOP-10 Antibody Description: Multifunctional transcription factor in ER stress response. Plays an essential role in the response to a wide variety of cell stresses and induces cell cycle arrest and apoptosis in response to ER stress. Plays a dual role both as an inhibitor of CCAAT/enhancer-binding protein (C/EBP) function and as an activator of other genes.

NCBI and Uniprot Product Information

• NCBI GI #: 21361118
• NCBI GeneID: 1649
• NCBI Accession #: NP_004074.2
• NCBI GenBank Nucleotide #: NM_004083.5
• UniProt Accession #: P35638; F8VS99
• NCBI Official Full Name: DNA damage-inducible transcript 3 protein isoform 2
• NCBI Official Synonym Full Names: DNA damage inducible transcript 3
• NCBI Official Symbol: DDIT3
• NCBI Official Synonym Symbols: CHOP; CEBPZ; CHOP10; CHOP-10; GADD153
• NCBI Protein Information: DNA damage-inducible transcript 3 protein
• UniProt Protein Name: DNA damage-inducible transcript 3 protein
• UniProt Gene Name: DDIT3
• UniProt Synonym Gene Names: CHOP; CHOP10; GADD153; DDIT-3; CHOP; CHOP-10
• UniProt Entry Name: DDIT3_HUMAN