Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-CYP3A5 Polyclonal Antibody – Cat# AAA200989 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-CYP3A5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Placenta)

Cytochrome P450 3A5 Isoform 1 (CYP3A5) Antibody – Rabbit Polyclonal

CYP3A5 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
CYP3A5; CP35; PCN3; CYPIIIA5; P450PCN3
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CYP3A5, Antibody; CYP3A5 antibody - N-terminal region; anti-CYP3A5 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AITDPDVIRTVLVKECYSVFTNRRSLGPVGFMKSAISLAEDEEWKRIRSL
Sequence Length
502
Applicable Applications for anti-CYP3A5 antibody
WB (Western Blot)
Homology
Cow: 79%; Dog: 91%; Guinea Pig: 92%; Horse: 86%; Human: 100%; Mouse: 82%; Pig: 93%; Rat: 79%; Sheep: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CYP3A5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-CYP3A5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Placenta)

Rabbit Anti-CYP3A5 Polyclonal Antibody – Cat# AAA200989 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-CYP3A5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Placenta)

IHC (Immunohistochemistry)

(Rabbit Anti-CYP3A5 antibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult Small intestineObserved Staining: Cytoplasm in hepatocytesPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Rabbit Anti-CYP3A5 Polyclonal Antibody – Cat# AAA200989 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Rabbit Anti-CYP3A5 antibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult Small intestineObserved Staining: Cytoplasm in hepatocytesPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-CYP3A5 antibody
This is a rabbit polyclonal antibody against CYP3A5. It was validated on Western Blot

Target Description: This gene,CYP3A5, encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by glucocorticoids and some pharmacological agents. The enzyme metabolizes drugs such as nifedipine and cyclosporine as well as the steroid hormones testosterone, progesterone and androstenedione. This gene is part of a cluster of cytochrome P450 genes on chromosome 7q21.1. This cluster includes a pseudogene, CYP3A5P1, which is very similar to CYP3A5. This similarity has caused some difficulty in determining whether cloned sequences represent the gene or the pseudogene. Multiple alternatively spliced transcript variants have been identified for this gene.
Product Categories/Family for anti-CYP3A5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57kDa
NCBI Official Full Name
cytochrome P450 3A5 isoform 1
NCBI Official Synonym Full Names
cytochrome P450 family 3 subfamily A member 5
NCBI Official Symbol
CYP3A5
NCBI Official Synonym Symbols
CP35; PCN3; CYPIIIA5; P450PCN3
NCBI Protein Information
cytochrome P450 3A5
UniProt Protein Name
Cytochrome P450 2J2
UniProt Gene Name
CYP2J2
UniProt Entry Name
CP2J2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The CYP3A5 cyp2j2 (Catalog #AAA200989) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CYP3A5 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's CYP3A5 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the CYP3A5 cyp2j2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AITDPDVIRT VLVKECYSVF TNRRSLGPVG FMKSAISLAE DEEWKRIRSL. It is sometimes possible for the material contained within the vial of "CYP3A5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.