Granulocyte Colony-Stimulating Factor Receptor Isoform D (CSF3R) Antibody – Rabbit Polyclonal
CSF3R Antibody - N-terminal region
Gene Names
CSF3R; SCN7; CD114; GCSFR
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CSF3R, Antibody; CSF3R Antibody - N-terminal region; anti-CSF3R antibody
Product Overview
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: HNLSCLMNLTTSSLICQWEPGPETHLPTSFTLKSFKSRGNCQTQGDSILD
Sequence Length
836
Applicable Applications for anti-CSF3R antibody
WB (Western Blot)
Homology
Cow: 92%; Dog: 92%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 92%; Rabbit: 93%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human CSF3R
Protein Size
836 amino acids
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-CSF3R antibody
This is a rabbit polyclonal antibody against CSF3R. It was validated on Western Blot
Target Description: The protein encoded by this gene is the receptor for colony stimulating factor 3, a cytokine that controls the production, differentiation, and function of granulocytes. The encoded protein, which is a member of the family of cytokine receptors, may also function in some cell surface adhesion or recognition processes. Alternatively spliced transcript variants have been described. Mutations in this gene are a cause of Kostmann syndrome, also known as severe congenital neutropenia.
Target Description: The protein encoded by this gene is the receptor for colony stimulating factor 3, a cytokine that controls the production, differentiation, and function of granulocytes. The encoded protein, which is a member of the family of cytokine receptors, may also function in some cell surface adhesion or recognition processes. Alternatively spliced transcript variants have been described. Mutations in this gene are a cause of Kostmann syndrome, also known as severe congenital neutropenia.
Product Categories/Family for anti-CSF3R antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
91kDa
NCBI Official Full Name
granulocyte colony-stimulating factor receptor isoform d
NCBI Official Synonym Full Names
colony stimulating factor 3 receptor
NCBI Official Symbol
CSF3R
NCBI Official Synonym Symbols
SCN7; CD114; GCSFR
NCBI Protein Information
granulocyte colony-stimulating factor receptor
UniProt Protein Name
Granulocyte colony-stimulating factor receptor
UniProt Gene Name
CSF3R
UniProt Synonym Gene Names
GCSFR; G-CSF receptor; G-CSF-R
UniProt Entry Name
CSF3R_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Additional Details
Product Notes
The CSF3R csf3r (Catalog #AAA197667) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CSF3R Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CSF3R can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the CSF3R csf3r for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: HNLSCLMNLT TSSLICQWEP GPETHLPTSF TLKSFKSRGN CQTQGDSILD. It is sometimes possible for the material contained within the vial of "CSF3R, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
