Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-CRY2 Polyclonal Antibody – Cat# AAA200246 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-CRY2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: U937 cell lysate)

Cryptochrome-2 (CRY2) Antibody – Rabbit Polyclonal

CRY2 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
CRY2; HCRY2; PHLL2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
CRY2, Antibody; CRY2 antibody - N-terminal region; anti-CRY2 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IELNGQKPPLTYKRFQAIISRMELPKKPVGLVTSQQMESCRAEIQENHDE
Sequence Length
593
Applicable Applications for anti-CRY2 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CRY2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-CRY2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: U937 cell lysate)

Rabbit Anti-CRY2 Polyclonal Antibody – Cat# AAA200246 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-CRY2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: U937 cell lysate)

WB (Western Blot)

(Host: RabbitTarget Name: CRY2Sample Tissue: Human RPMI 8226 Whole CellAntibody Dilution: 1ug/ml)

Rabbit Anti-CRY2 Polyclonal Antibody – Cat# AAA200246 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: CRY2Sample Tissue: Human RPMI 8226 Whole CellAntibody Dilution: 1ug/ml)

IHC (Immunohistochemistry)

(Rabbit Anti-CRY2 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Rabbit Anti-CRY2 Polyclonal Antibody – Cat# AAA200246 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Rabbit Anti-CRY2 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-CRY2 antibody
This is a rabbit polyclonal antibody against CRY2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: CRY2 is a blue light-dependent regulator of the circadian feedback loop.CRY2 inhibits CLOCK NPAS2-ARNTL E box-mediated transcription. CRY2 acts, in conjunction with CRY2, in maintaining period length and circadian rhythmicity.CRY2 has no photolyase activity. CRY2 is capable of translocating circadian clock core proteins such as PER proteins to the nucleus.CRY2 may inhibit CLOCK NPAS2-ARNTL transcriptional activity through stabilizing the unphosphorylated form of ARNTL.
Product Categories/Family for anti-CRY2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
67kDa
NCBI Official Full Name
Cryptochrome-2
NCBI Official Synonym Full Names
cryptochrome circadian regulator 2
NCBI Official Symbol
CRY2
NCBI Official Synonym Symbols
HCRY2; PHLL2
NCBI Protein Information
cryptochrome-2
UniProt Protein Name
Cryptochrome-2
UniProt Gene Name
CRY2
UniProt Synonym Gene Names
KIAA0658
UniProt Entry Name
CRY2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The CRY2 cry2 (Catalog #AAA200246) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CRY2 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CRY2 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the CRY2 cry2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IELNGQKPPL TYKRFQAIIS RMELPKKPVG LVTSQQMESC RAEIQENHDE. It is sometimes possible for the material contained within the vial of "CRY2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.