Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-CNN1 Polyclonal Antibody – Cat# AAA199875 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-CNN1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Hela cell lysate)

Calponin-1 Isoform 1 (CNN1) Antibody – Rabbit Polyclonal

CNN1 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
CNN1; SMCC; Sm-Calp; HEL-S-14
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rat, Sheep, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CNN1, Antibody; CNN1 antibody - N-terminal region; anti-CNN1 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MSSAHFNRGPAYGLSAEVKNKLAQKYDHQREQELREWIEGVTGRRIGNNF
Sequence Length
297
Applicable Applications for anti-CNN1 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rat: 100%; Sheep: 100%; Zebrafish: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CNN1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-CNN1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Hela cell lysate)

Rabbit Anti-CNN1 Polyclonal Antibody – Cat# AAA199875 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-CNN1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Hela cell lysate)

WB (Western Blot)

(Lanes:1. 20 ug murine non-pregnant uteria tissue 2. 20 ug murine non-laboring uterine tissue 3. 20 ug murine laboring uterine tissue 4. 20 ug murine preterm laboring uterine tissuePrimary Antibody Dilution:1:2000Secondary Antibody:Goat anti-rabbit-Alexa Fluor 680Secondary Antibody Dilution:1:25,000Gene Name:CNN1Submitted by:Anonymous)

Rabbit Anti-CNN1 Polyclonal Antibody – Cat# AAA199875 – WB (Western Blot) WB (Western Blot) (Lanes:1. 20 ug murine non-pregnant uteria tissue 2. 20 ug murine non-laboring uterine tissue 3. 20 ug murine laboring uterine tissue 4. 20 ug murine preterm laboring uterine tissuePrimary Antibody Dilution:1:2000Secondary Antibody:Goat anti-rabbit-Alexa Fluor 680Secondary Antibody Dilution:1:25,000Gene Name:CNN1Submitted by:Anonymous)
Related Product Information for anti-CNN1 antibody
This is a rabbit polyclonal antibody against CNN1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: CNN1 is a thin filament-associated protein that is implicated in the regulation and modulation of smooth muscle contraction. It is capable of binding to actin, calmodulin, troponin C and tropomyosin. The interaction of calponin with actin inhibits the actomyosin Mg-ATPase activity.
Product Categories/Family for anti-CNN1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33kDa
NCBI Official Full Name
calponin-1 isoform 1
NCBI Official Synonym Full Names
calponin 1
NCBI Official Symbol
CNN1
NCBI Official Synonym Symbols
SMCC; Sm-Calp; HEL-S-14
NCBI Protein Information
calponin-1
UniProt Protein Name
Calponin-1
UniProt Gene Name
CNN1
UniProt Entry Name
CNN1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The CNN1 cnn1 (Catalog #AAA199875) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CNN1 antibody - N-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CNN1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the CNN1 cnn1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MSSAHFNRGP AYGLSAEVKN KLAQKYDHQR EQELREWIEG VTGRRIGNNF. It is sometimes possible for the material contained within the vial of "CNN1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.