T-Cell Surface Glycoprotein CD3 Delta Chain (CD3D) Antibody – Rabbit Polyclonal
Polyclonal Antibody to Cluster Of Differentiation 3d (CD3d)
Product Overview
MGHHHHHHSGSEF-FKIQVTEYEDKVFVTCNTSVMHLDGTVEGWFAKNKTLNLGKGVLDPRGIYLCNGTEQLAKVVSSVQVHYRMCQNCVELDSGTM
WB (Western Blot)
(Western Blot: Sample: Rat Lymph node lysate; Primary Ab: 1ug/ml Rabbit Anti-Rat CD3d Antibody Second Ab: 0.2ug/mL HRP-Linked Caprine Anti-Rabbit IgG Polyclonal Antibody)
NCBI and Uniprot Product Information
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Additional Details
Product Notes
The CD3d cd3d (Catalog #AAA131044) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Polyclonal Antibody to Cluster Of Differentiation 3d (CD3d) reacts with Rat, Human, Mouse, Dog, Pig and may cross-react with other species as described in the data sheet. AAA Biotech's Cluster Of Differentiation 3d (CD3d) can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), ELISA, IHC (Immunohistochemistry), ICC (Immunocytochemistry). Researchers should empirically determine the suitability of the CD3d cd3d for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Antigen: The target protein is fused with N-terminal His-Tag and its sequence is listed below. MGHHHHHHSG SEF-FKIQVT EYEDKVFVTC NTSVMHLDGT VEGWFAKNKT LNLGKGVLDP RGIYLCNGTE QLAKVVSSVQ VHYRMCQNCV ELDSGTM. It is sometimes possible for the material contained within the vial of "Cluster Of Differentiation 3d (CD3d), Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
