Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-CLTA Polyclonal Antibody – Cat# AAA200935 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-CLTA Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human brain)

Clathrin Light Chain A Isoform A (CLTA) Antibody – Rabbit Polyclonal

CLTA antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
CLTA; LCA
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
CLTA, Antibody; CLTA antibody - C-terminal region; anti-CLTA antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KELEEWYARQDEQLQKTKANNRAAEEAFVNDIDESSPGTEWERVARLCDF
Sequence Length
218
Applicable Applications for anti-CLTA antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 75%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human CLTA
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-CLTA Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human brain)

Rabbit Anti-CLTA Polyclonal Antibody – Cat# AAA200935 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-CLTA Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human brain)

IHC (Immunohistochemistry)

(Rabbit Anti-CLTA antibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult ProstateObserved Staining: Cytoplasm in hepatocytesPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Rabbit Anti-CLTA Polyclonal Antibody – Cat# AAA200935 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Rabbit Anti-CLTA antibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult ProstateObserved Staining: Cytoplasm in hepatocytesPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-CLTA antibody
This is a rabbit polyclonal antibody against CLTA. It was validated on Western Blot

Target Description: Clathrin is a large, soluble protein composed of heavy and light chains. It functions as the main structural component of the lattice-type cytoplasmic face of coated pits and vesicles which entrap specific macromolecules during receptor-mediated endocytosis. This gene encodes one of two clathrin light chain proteins which are believed to function as regulatory elements. Alternative splicing results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 8 and 12.
Product Categories/Family for anti-CLTA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24kDa
NCBI Official Full Name
clathrin light chain A isoform a
NCBI Official Synonym Full Names
clathrin light chain A
NCBI Official Symbol
CLTA
NCBI Official Synonym Symbols
LCA
NCBI Protein Information
clathrin light chain A
UniProt Protein Name
Clathrin light chain A
UniProt Gene Name
CLTA
UniProt Synonym Gene Names
Lca
UniProt Entry Name
CLCA_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The CLTA clta (Catalog #AAA200935) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CLTA antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CLTA can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the CLTA clta for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KELEEWYARQ DEQLQKTKAN NRAAEEAFVN DIDESSPGTE WERVARLCDF. It is sometimes possible for the material contained within the vial of "CLTA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.