Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-CLIC1 Polyclonal Antibody – Cat# AAA197912 – WB (Western Blot) WB (Western Blot) (Lanes:Lane 1: 30ug mouse renal epithelial lysateLane 2: 30ug mouse renal epithelial lysateLane 3: 30ug mouse renal epithelial lysatePrimary Antibody Dilution:1:500Secondary Antibody:Anti-rabbit-HRPSecondary Antibody Dilution:1:2500Gene Name:CLIC1Submitted by:Dr. JUNMING FAN,ECU)

Chloride Intracellular Channel Protein 1 (CLIC1) Antibody – Rabbit Polyclonal

CLIC1 antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
CLIC1; G6; CL1C1; NCC27
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
CLIC1, Antibody; CLIC1 antibody - C-terminal region; anti-CLIC1 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFAST
Sequence Length
241
Applicable Applications for anti-CLIC1 antibody
WB (Western Blot)
Homology
Cow: 83%; Dog: 92%; Goat: 83%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human CLIC1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Lanes:Lane 1: 30ug mouse renal epithelial lysateLane 2: 30ug mouse renal epithelial lysateLane 3: 30ug mouse renal epithelial lysatePrimary Antibody Dilution:1:500Secondary Antibody:Anti-rabbit-HRPSecondary Antibody Dilution:1:2500Gene Name:CLIC1Submitted by:Dr. JUNMING FAN,ECU)

Rabbit Anti-CLIC1 Polyclonal Antibody – Cat# AAA197912 – WB (Western Blot) WB (Western Blot) (Lanes:Lane 1: 30ug mouse renal epithelial lysateLane 2: 30ug mouse renal epithelial lysateLane 3: 30ug mouse renal epithelial lysatePrimary Antibody Dilution:1:500Secondary Antibody:Anti-rabbit-HRPSecondary Antibody Dilution:1:2500Gene Name:CLIC1Submitted by:Dr. JUNMING FAN,ECU)

WB (Western Blot)

(CLIC1 antibody - C-terminal region validated by WB using purified recombinant CLIC1 protein and transfected lysate)

Rabbit Anti-CLIC1 Polyclonal Antibody – Cat# AAA197912 – WB (Western Blot) WB (Western Blot) (CLIC1 antibody - C-terminal region validated by WB using purified recombinant CLIC1 protein and transfected lysate)

WB (Western Blot)

(Sample Type: HumanSample Type: Purified Recombinant CLIC-1 proteinPrimary Dilution: 1:1000)

Rabbit Anti-CLIC1 Polyclonal Antibody – Cat# AAA197912 – WB (Western Blot) WB (Western Blot) (Sample Type: HumanSample Type: Purified Recombinant CLIC-1 proteinPrimary Dilution: 1:1000)
Related Product Information for anti-CLIC1 antibody
This is a rabbit polyclonal antibody against CLIon Channel1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Chloride intracellular channel 1 is a member of the p64 family, a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. CLIon Channel1 encodes a protein that localizes principally to the cell nucleus and exhibits both nuclear and plasma membrane chloride ion channel activity.Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 1 is a member of the p64 family; the protein localizes principally to the cell nucleus and exhibits both nuclear and plasma membrane chloride ion channel activity.
Product Categories/Family for anti-CLIC1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27kDa
NCBI Official Full Name
chloride intracellular channel protein 1
NCBI Official Synonym Full Names
chloride intracellular channel 1
NCBI Official Symbol
CLIC1
NCBI Official Synonym Symbols
G6; CL1C1; NCC27
NCBI Protein Information
chloride intracellular channel protein 1
UniProt Protein Name
Chloride intracellular channel protein 1
UniProt Gene Name
CLIC1
UniProt Synonym Gene Names
G6; NCC27; NCC27; hRNCC
UniProt Entry Name
CLIC1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The CLIC1 clic1 (Catalog #AAA197912) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CLIC1 antibody - C-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CLIC1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the CLIC1 clic1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LTLADCNLLP KLHIVQVVCK KYRGFTIPEA FRGVHRYLSN AYAREEFAST. It is sometimes possible for the material contained within the vial of "CLIC1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.