Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-CHRM1 Polyclonal Antibody – Cat# AAA201051 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-CHRM1 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Bladder)

Muscarinic Acetylcholine Receptor M1 (CHRM1) Antibody – Rabbit Polyclonal

CHRM1 Antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
CHRM1; M1; HM1; M1R
Reactivity
Tested Species Reactivity: Human
Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CHRM1, Antibody; CHRM1 Antibody - C-terminal region; anti-CHRM1 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Tested Species Reactivity: Human
Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: VKRPTKKGRDRAGKGQKPRGKEQLAKRKTFSLVKEKKAARTLSAILLAFI
Sequence Length
460
Applicable Applications for anti-CHRM1 antibody
WB (Western Blot)
Homology
Cow: 93%; Dog: 86%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human CHRM1
Protein Size (# AA)
460 amino acids
Protein Interactions
CDC14A; GPRASP2; GPRASP1; Dlg4; GNAI2;
Blocking Peptide
For anti-CHRM1 (MBS3215052) antibody is Catalog #
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-CHRM1 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Bladder)

Rabbit Anti-CHRM1 Polyclonal Antibody – Cat# AAA201051 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-CHRM1 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Bladder)
Related Product Information for anti-CHRM1 antibody
Description of Target: The muscarinic cholinergic receptors belong to a larger family of G protein-coupled receptors. The functional diversity of these receptors is defined by the binding of acetylcholine and includes cellular responses such as adenylate cyclase inhibition, phosphoinositide degeneration, and potassium channel mediation. Muscarinic receptors influence many effects of acetylcholine in the central and peripheral nervous system. The muscarinic cholinergic receptor 1 is involved in mediation of vagally-induced bronchoconstriction and in the acid secretion of the gastrointestinal tract. The gene encoding this receptor is localized to 11q13.
Product Categories/Family for anti-CHRM1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51kDa
NCBI Official Full Name
muscarinic acetylcholine receptor M1
NCBI Official Synonym Full Names
cholinergic receptor muscarinic 1
NCBI Official Symbol
CHRM1
NCBI Official Synonym Symbols
M1; HM1; M1R
NCBI Protein Information
muscarinic acetylcholine receptor M1
UniProt Protein Name
Muscarinic acetylcholine receptor M1
UniProt Gene Name
CHRM1
UniProt Entry Name
ACM1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The CHRM1 chrm1 (Catalog #AAA201051) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CHRM1 Antibody - C-terminal region reacts with Tested Species Reactivity: Human Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's CHRM1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the CHRM1 chrm1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VKRPTKKGRD RAGKGQKPRG KEQLAKRKTF SLVKEKKAAR TLSAILLAFI. It is sometimes possible for the material contained within the vial of "CHRM1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.