Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-CDK3 Polyclonal Antibody – Cat# AAA201675 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-CDK3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Hela cell lysate)

Cyclin-Dependent Kinase 3 (CDK3) Antibody – Rabbit Polyclonal

CDK3 antibody - C-terminal region

Average rating 0.0
No ratings yet
Reactivity
Cow, Dog, Human, Mouse, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CDK3, Antibody; CDK3 antibody - C-terminal region; anti-CDK3 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Dog, Human, Mouse, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NLEPEGRDLLMQLLQYDPSQRITAKTALAHPYFSSPEPSPAARQYVLQRF
Sequence Length
305
Applicable Applications for anti-CDK3 antibody
WB (Western Blot)
Homology
Cow: 81%; Dog: 86%; Human: 100%; Mouse: 93%; Rabbit: 87%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human CDK3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-CDK3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Hela cell lysate)

Rabbit Anti-CDK3 Polyclonal Antibody – Cat# AAA201675 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-CDK3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Hela cell lysate)

WB (Western Blot)

(Lanes:1: 40ug mouse heart lysate, 2: 40ug mouse heart lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:10000Gene Name:CDK3Submitted by:Anonymous)

Rabbit Anti-CDK3 Polyclonal Antibody – Cat# AAA201675 – WB (Western Blot) WB (Western Blot) (Lanes:1: 40ug mouse heart lysate, 2: 40ug mouse heart lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:10000Gene Name:CDK3Submitted by:Anonymous)
Related Product Information for anti-CDK3 antibody
This is a rabbit polyclonal antibody against CDK3. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: CDK3 is a member of the cyclin-dependent protein kinase family. The protein promotes entry into S phase, in part by activating members of the E2F family of transcription factors. The protein also associates with cyclin C and phosphorylates the retinoblastoma 1 protein to promote exit from G0.This gene encodes a member of the cyclin-dependent protein kinase family. The protein promotes entry into S phase, in part by activating members of the E2F family of transcription factors. The protein also associates with cyclin C and phosphorylates the retinoblastoma 1 protein to promote exit from G0. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-CDK3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35kDa
NCBI Official Full Name
cyclin-dependent kinase 3
NCBI Official Synonym Full Names
cyclin dependent kinase 3
NCBI Official Symbol
CDK3
NCBI Protein Information
cyclin-dependent kinase 3
UniProt Protein Name
Cyclin-dependent kinase 3
UniProt Gene Name
CDK3
UniProt Synonym Gene Names
CDKN3
UniProt Entry Name
CDK3_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The CDK3 cdk3 (Catalog #AAA201675) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CDK3 antibody - C-terminal region reacts with Cow, Dog, Human, Mouse, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's CDK3 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the CDK3 cdk3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NLEPEGRDLL MQLLQYDPSQ RITAKTALAH PYFSSPEPSP AARQYVLQRF. It is sometimes possible for the material contained within the vial of "CDK3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.