Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-CCNH Polyclonal Antibody – Cat# AAA201679 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-CCNH Antibody Titration: 1ug/mlPositive Control: Jurkat cell lysateCCNH is supported by BioGPS gene expression data to be expressed in Jurkat)

Cyclin-H Isoform 1 (CCNH) Antibody – Rabbit Polyclonal

CCNH antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
CCNH; CAK; p34; p37; CycH
Reactivity
Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
CCNH, Antibody; CCNH antibody - C-terminal region; anti-CCNH antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KQKLERCHSAELALNVITKKRKGYEDDDYVSKKSKHEEEEWTDDDLVESL
Sequence Length
323
Applicable Applications for anti-CCNH antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 83%; Rabbit: 83%; Rat: 83%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human CCNH
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-CCNH Antibody Titration: 1ug/mlPositive Control: Jurkat cell lysateCCNH is supported by BioGPS gene expression data to be expressed in Jurkat)

Rabbit Anti-CCNH Polyclonal Antibody – Cat# AAA201679 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-CCNH Antibody Titration: 1ug/mlPositive Control: Jurkat cell lysateCCNH is supported by BioGPS gene expression data to be expressed in Jurkat)

IHC (Immunohistochemistry)

(Human Lung)

Rabbit Anti-CCNH Polyclonal Antibody – Cat# AAA201679 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Human Lung)
Related Product Information for anti-CCNH antibody
This is a rabbit polyclonal antibody against CCNH. It was validated on Western Blot and immunohistochemistry

Target Description: Cyclin H regulates CDK7, the catalytic subunit of the CDK- activating kinase (CAK) enzymatic complex. CAK activates the cyclin-associated kinases CDC2/CDK1, CDK2, CDK4 and CDK6 by threonine phosphorylation. CAK complexed to the core-TFIIH basal transcription factor activates RNA polymerase II by serine phosphorylation of the repetitive carboxyl-terminus domain (CTD) of its large subunit (POLR2A), allowing its escape from the promoter and elongation of the transcripts. It is involved in cell cycle control and in RNA transcription by RNA polymerase II. Its expression and activity are constant throughout the cell cycle.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
902
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38kDa
NCBI Official Full Name
cyclin-H isoform 1
NCBI Official Synonym Full Names
cyclin H
NCBI Official Symbol
CCNH
NCBI Official Synonym Symbols
CAK; p34; p37; CycH
NCBI Protein Information
cyclin-H
UniProt Protein Name
Cyclin-H
UniProt Gene Name
CCNH
UniProt Entry Name
CCNH_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The CCNH ccnh (Catalog #AAA201679) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CCNH antibody - C-terminal region reacts with Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CCNH can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the CCNH ccnh for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KQKLERCHSA ELALNVITKK RKGYEDDDYV SKKSKHEEEE WTDDDLVESL. It is sometimes possible for the material contained within the vial of "CCNH, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.