Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-CBX4 Polyclonal Antibody – Cat# AAA198485 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: CBX4Sample Type: Fetal Brain lysatesAntibody Dilution: 1.0ug/ml)

E3 SUMO-Protein Ligase CBX4 (CBX4) Antibody – Rabbit Polyclonal

CBX4 Antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
CBX4; PC2; NBP16
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CBX4, Antibody; CBX4 Antibody - middle region; anti-CBX4 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KWRGWSPKYNTWEPEENILDPRLLIAFQNRERQEQLMGYRKRGPKPKPLV
Sequence Length
290
Applicable Applications for anti-CBX4 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human CBX4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Host: RabbitTarget Name: CBX4Sample Type: Fetal Brain lysatesAntibody Dilution: 1.0ug/ml)

Rabbit Anti-CBX4 Polyclonal Antibody – Cat# AAA198485 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: CBX4Sample Type: Fetal Brain lysatesAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: MouseTarget Name: CBX8Sample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)

Rabbit Anti-CBX4 Polyclonal Antibody – Cat# AAA198485 – WB (Western Blot) WB (Western Blot) (Host: MouseTarget Name: CBX8Sample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)
Related Product Information for anti-CBX4 antibody
This is a rabbit polyclonal antibody against CBX4. It was validated on Western Blot

Target Description: CBX4 is an E3 SUMO-protein ligase which facilitates SUMO1 conjugation by UBE2I. It is involved in the sumoylation of HNRNPK, a p53/TP53 transcriptional coactivator, hence indirectly regulates p53/TP53 transcriptional activation resulting in p21/CDKN1A expression. It monosumoylates ZNF131.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31kDa
NCBI Official Full Name
E3 SUMO-protein ligase CBX4
NCBI Official Synonym Full Names
chromobox 4
NCBI Official Symbol
CBX4
NCBI Official Synonym Symbols
PC2; NBP16
NCBI Protein Information
E3 SUMO-protein ligase CBX4
UniProt Protein Name
E3 SUMO-protein ligase CBX4
UniProt Gene Name
CBX4
UniProt Synonym Gene Names
Pc2; hPc2
UniProt Entry Name
CBX4_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The CBX4 cbx4 (Catalog #AAA198485) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CBX4 Antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CBX4 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the CBX4 cbx4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KWRGWSPKYN TWEPEENILD PRLLIAFQNR ERQEQLMGYR KRGPKPKPLV. It is sometimes possible for the material contained within the vial of "CBX4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.