Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-CACNG1 Polyclonal Antibody – Cat# AAA162871 – IHC (Immunohiostchemistry) IHC (Immunohiostchemistry) (CACNG1/CACNG Antibody-Human Skeletal Muscle: Formalin-Fixed, Paraffin-Embedded (FFPE))

Voltage-Dependent Calcium Channel Gamma-1 Subunit (CACNG1) Antibody – Rabbit Polyclonal

CACNG1/CACNG Rabbit anti-Human Polyclonal Antibody

Average rating 0.0
No ratings yet
Gene Names
CACNG1; CACNLG
Reactivity
Mouse, Rat, Human
Applications
Western Blot, Immunohistochemistry, Immunohistochemistry
Purity
Affinity purified
Synonyms
CACNG1/CACNG, Antibody; CACNG1/CACNG Rabbit anti-Human Polyclonal Antibody; IHC-plus CACNG1/CACNG Antibody; CACNG1; CACNG; CACNLG; Gamma 1; anti-CACNG1 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Mouse, Rat, Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purified
Form/Format
PBS, pH7.3, 0.02% Sodium Azide, 50% Glycerol
Applicable Applications for anti-CACNG1 antibody
WB (Western Blot), IHC (Immunohistochemistry), IHC (Immunohistochemistry)
Target
Human CACNG1/CACNG
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 30-110 of human CACNG1 (NP_000718.1). DHWAVLSPHMEHHNTTCEAAHFGLWRICTKRIPMDDSKTCGPITLPGEKNCSYFRHFNPGESSEIFEFTTQKEYSISAAAI
Conjugation
Unconjugated
Family
Ion Channel
Subfamily
Calcium channel-gamma subunit
Preparation and Storage
Store at -20 degree C. Avoid freeze-thaw cycles.

IHC (Immunohiostchemistry)

(CACNG1/CACNG Antibody-Human Skeletal Muscle: Formalin-Fixed, Paraffin-Embedded (FFPE))

Rabbit Anti-CACNG1 Polyclonal Antibody – Cat# AAA162871 – IHC (Immunohiostchemistry) IHC (Immunohiostchemistry) (CACNG1/CACNG Antibody-Human Skeletal Muscle: Formalin-Fixed, Paraffin-Embedded (FFPE))

WB (Western Blot)

(CACNG1/CACNG Antibody-Western blot analysis of extracts of various cell lines, using CACNG1 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 10s.)

Rabbit Anti-CACNG1 Polyclonal Antibody – Cat# AAA162871 – WB (Western Blot) WB (Western Blot) (CACNG1/CACNG Antibody-Western blot analysis of extracts of various cell lines, using CACNG1 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 10s.)
Related Product Information for anti-CACNG1 antibody
CACNG antibody is an unconjugated rabbit polyclonal antibody to CACNG (CACNG1) from human. It is reactive with mouse and rat. Validated for IHC and WB. Tested on 20 paraffin-embedded human tissues.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
786
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25,028 Da
NCBI Official Full Name
voltage-dependent calcium channel gamma-1 subunit
NCBI Official Synonym Full Names
calcium channel, voltage-dependent, gamma subunit 1
NCBI Official Symbol
CACNG1
NCBI Official Synonym Symbols
CACNLG
NCBI Protein Information
voltage-dependent calcium channel gamma-1 subunit; L-type calcium channel gamma polypeptide; neuronal dihydropyridine-sensitive calcium channel gamma subunit; dihydropyridine-sensitive L-type, skeletal muscle calcium channel subunit gamma
UniProt Protein Name
Voltage-dependent calcium channel gamma-1 subunit
UniProt Gene Name
CACNG1
UniProt Synonym Gene Names
CACNLG
UniProt Entry Name
CCG1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The CACNG1 cacng1 (Catalog #AAA162871) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CACNG1/CACNG Rabbit anti-Human Polyclonal Antibody reacts with Mouse, Rat, Human and may cross-react with other species as described in the data sheet. AAA Biotech's CACNG1/CACNG can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the CACNG1 cacng1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CACNG1/CACNG, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.